Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9993
Gene name
LocationContig_77:38055..38646
Strand-
Gene length (bp)591
Transcript length (bp)591
Coding sequence length (bp)591
Protein length (aa) 197

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9993
MKTAAILVSVVGLATAGPTYPKCDEVGLQLHDQVLPVGIDMTDCRYTECKEADNGRYHCPLECDNKAIGHAVFNS
QSDLHDLLRNQRVFRVGEFKEKCPYIPDKFEEGFKYPNDSEFKDCMEVGLQVNRSYLYWLVVTDAACAAQKCMTN
QFSTGCAIMCSGTRFGEVRFSNSSDADQFIEEQKSNKVGEFQDCQD*
Coding >Hirsu2|9993
ATGAAGACTGCAGCCATCCTTGTCTCTGTCGTTGGACTGGCAACGGCTGGTCCAACGTATCCGAAGTGCGACGAA
GTCGGCCTACAGCTCCACGATCAGGTGTTGCCGGTTGGCATCGATATGACAGACTGTCGGTACACTGAATGCAAG
GAGGCCGACAACGGCAGATATCATTGCCCGCTCGAATGCGATAATAAAGCCATTGGCCACGCTGTGTTTAACAGT
CAATCGGATTTGCACGACCTACTACGCAACCAGCGAGTGTTCCGCGTCGGCGAATTCAAAGAAAAGTGTCCGTAT
ATACCAGACAAGTTTGAAGAAGGCTTCAAGTACCCAAACGACTCCGAATTCAAAGACTGCATGGAAGTTGGCCTT
CAGGTTAATCGCTCCTACCTTTACTGGCTTGTTGTCACAGACGCCGCTTGCGCTGCTCAGAAATGCATGACGAAC
CAGTTCAGCACTGGTTGTGCCATTATGTGCAGCGGGACACGTTTCGGCGAGGTTCGGTTCTCAAATAGCAGCGAC
GCAGACCAATTCATTGAGGAGCAAAAGTCGAACAAGGTTGGCGAGTTCCAAGATTGTCAGGACTAG
Transcript >Hirsu2|9993
ATGAAGACTGCAGCCATCCTTGTCTCTGTCGTTGGACTGGCAACGGCTGGTCCAACGTATCCGAAGTGCGACGAA
GTCGGCCTACAGCTCCACGATCAGGTGTTGCCGGTTGGCATCGATATGACAGACTGTCGGTACACTGAATGCAAG
GAGGCCGACAACGGCAGATATCATTGCCCGCTCGAATGCGATAATAAAGCCATTGGCCACGCTGTGTTTAACAGT
CAATCGGATTTGCACGACCTACTACGCAACCAGCGAGTGTTCCGCGTCGGCGAATTCAAAGAAAAGTGTCCGTAT
ATACCAGACAAGTTTGAAGAAGGCTTCAAGTACCCAAACGACTCCGAATTCAAAGACTGCATGGAAGTTGGCCTT
CAGGTTAATCGCTCCTACCTTTACTGGCTTGTTGTCACAGACGCCGCTTGCGCTGCTCAGAAATGCATGACGAAC
CAGTTCAGCACTGGTTGTGCCATTATGTGCAGCGGGACACGTTTCGGCGAGGTTCGGTTCTCAAATAGCAGCGAC
GCAGACCAATTCATTGAGGAGCAAAAGTCGAACAAGGTTGGCGAGTTCCAAGATTGTCAGGACTAG
Gene >Hirsu2|9993
ATGAAGACTGCAGCCATCCTTGTCTCTGTCGTTGGACTGGCAACGGCTGGTCCAACGTATCCGAAGTGCGACGAA
GTCGGCCTACAGCTCCACGATCAGGTGTTGCCGGTTGGCATCGATATGACAGACTGTCGGTACACTGAATGCAAG
GAGGCCGACAACGGCAGATATCATTGCCCGCTCGAATGCGATAATAAAGCCATTGGCCACGCTGTGTTTAACAGT
CAATCGGATTTGCACGACCTACTACGCAACCAGCGAGTGTTCCGCGTCGGCGAATTCAAAGAAAAGTGTCCGTAT
ATACCAGACAAGTTTGAAGAAGGCTTCAAGTACCCAAACGACTCCGAATTCAAAGACTGCATGGAAGTTGGCCTT
CAGGTTAATCGCTCCTACCTTTACTGGCTTGTTGTCACAGACGCCGCTTGCGCTGCTCAGAAATGCATGACGAAC
CAGTTCAGCACTGGTTGTGCCATTATGTGCAGCGGGACACGTTTCGGCGAGGTTCGGTTCTCAAATAGCAGCGAC
GCAGACCAATTCATTGAGGAGCAAAAGTCGAACAAGGTTGGCGAGTTCCAAGATTGTCAGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail