Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9983
Gene name
LocationContig_77:20265..20658
Strand+
Gene length (bp)393
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00043 GST_C Glutathione S-transferase, C-terminal domain 6.2E-13 21 100
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 1.8E-07 30 93
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 6.3E-07 14 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00717|STCT_EMENI Putative sterigmatocystin biosynthesis protein stcT OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcT PE=4 SV=1 1 105 7.0E-23
sp|P29547|EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAM1 PE=1 SV=2 2 115 6.0E-19
sp|Q90YC0|EF1G_CARAU Elongation factor 1-gamma OS=Carassius auratus GN=eef1g PE=2 SV=1 1 116 7.0E-16
sp|Q6PE25|EF1G_DANRE Elongation factor 1-gamma OS=Danio rerio GN=eef1g PE=2 SV=1 1 116 2.0E-15
sp|B5BP46|YP52_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.02c PE=3 SV=1 1 107 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00717|STCT_EMENI Putative sterigmatocystin biosynthesis protein stcT OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcT PE=4 SV=1 1 105 7.0E-23
sp|P29547|EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAM1 PE=1 SV=2 2 115 6.0E-19
sp|Q90YC0|EF1G_CARAU Elongation factor 1-gamma OS=Carassius auratus GN=eef1g PE=2 SV=1 1 116 7.0E-16
sp|Q6PE25|EF1G_DANRE Elongation factor 1-gamma OS=Danio rerio GN=eef1g PE=2 SV=1 1 116 2.0E-15
sp|B5BP46|YP52_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.02c PE=3 SV=1 1 107 6.0E-15
sp|P26642|EF1GA_XENLA Elongation factor 1-gamma-A OS=Xenopus laevis GN=eef1g-a PE=1 SV=1 1 116 6.0E-14
sp|P26641|EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens GN=EEF1G PE=1 SV=3 1 116 1.0E-13
sp|Q29387|EF1G_PIG Elongation factor 1-gamma (Fragment) OS=Sus scrofa GN=EEF1G PE=2 SV=2 1 116 2.0E-13
sp|Q4R7H5|EF1G_MACFA Elongation factor 1-gamma OS=Macaca fascicularis GN=EEF1G PE=2 SV=1 1 116 4.0E-13
sp|A2Q127|EF1G_HORSE Elongation factor 1-gamma OS=Equus caballus GN=EEF1G PE=2 SV=1 1 116 4.0E-13
sp|Q3SZV3|EF1G_BOVIN Elongation factor 1-gamma OS=Bos taurus GN=EEF1G PE=2 SV=1 1 116 5.0E-13
sp|P29694|EF1G_RABIT Elongation factor 1-gamma OS=Oryctolagus cuniculus GN=EEF1G PE=2 SV=3 1 116 5.0E-13
sp|P12261|EF1G_ARTSA Elongation factor 1-gamma OS=Artemia salina PE=1 SV=3 1 116 5.0E-13
sp|Q68FR6|EF1G_RAT Elongation factor 1-gamma OS=Rattus norvegicus GN=Eef1g PE=2 SV=3 1 116 7.0E-13
sp|Q9D8N0|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3 1 116 7.0E-13
sp|O74830|YC12_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.02 PE=3 SV=1 1 99 2.0E-12
sp|Q91375|EF1GB_XENLA Elongation factor 1-gamma-B OS=Xenopus laevis GN=eef1g-b PE=2 SV=1 1 116 2.0E-12
sp|P42936|YG4D_YEAST Putative elongation factor 1 gamma homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR201C PE=4 SV=3 2 96 3.0E-11
sp|P36008|EF1G2_YEAST Elongation factor 1-gamma 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF4 PE=1 SV=1 2 124 3.0E-11
sp|Q6YW46|EF1G2_ORYSJ Elongation factor 1-gamma 2 OS=Oryza sativa subsp. japonica GN=Os02g0220500 PE=2 SV=2 2 129 2.0E-10
sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 1 114 2.0E-10
sp|P54412|EF1G_CAEEL Probable elongation factor 1-gamma OS=Caenorhabditis elegans GN=eef-1G PE=3 SV=1 1 129 2.0E-10
sp|Q9FVT2|EF1G2_ARATH Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana GN=At1g57720 PE=2 SV=1 1 123 4.0E-10
sp|Q9FUM1|EF1G_PRUAV Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1 1 130 4.0E-10
sp|O04487|EF1G1_ARATH Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana GN=At1g09640 PE=2 SV=1 1 113 8.0E-10
sp|Q9ZRI7|EF1G1_ORYSJ Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1 1 106 7.0E-09
sp|Q9NJH0|EF1G_DROME Elongation factor 1-gamma OS=Drosophila melanogaster GN=Ef1gamma PE=2 SV=2 1 130 9.0E-09
sp|P40921|EF1G_SCHPO Elongation factor 1-gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 2 121 1.0E-07
sp|Q5Z627|EF1G3_ORYSJ Elongation factor 1-gamma 3 OS=Oryza sativa subsp. japonica GN=Os06g0571400 PE=2 SV=1 1 106 1.0E-07
sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens GN=VARS PE=1 SV=4 39 130 2.0E-06
sp|Q04462|SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus GN=Vars PE=2 SV=2 39 106 3.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6176 0.2587 0.0483 0.1112 0.3379 0.0819 0.1771 0.223 0.2125 0.3416

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6810
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5921
Ophiocordyceps australis map64 (Brazil) OphauB2|1452
Ophiocordyceps camponoti-rufipedis Ophun1|7145
Ophiocordyceps subramaniannii Hirsu2|9983 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9983
MSFFNSEILIPLADWFRPLAGKAPYDKQSVEKCSQATLKAVKVVEEYLQGRTFLVGESFSLADLFCASLLFRGFQ
FFFDKQWRLEHPNVTRWYGNVTDQPIYAAVVPKTEYLEKPALTNKAPEKPFVAKS*
Coding >Hirsu2|9983
ATGTCCTTCTTCAACTCTGAGATCCTCATCCCCCTAGCCGACTGGTTCCGCCCCCTGGCCGGCAAGGCGCCCTAC
GACAAGCAGTCGGTGGAGAAGTGTTCCCAGGCCACTCTGAAGGCTGTCAAGGTCGTCGAGGAATATCTTCAAGGT
CGCACATTCCTGGTGGGCGAGTCCTTCAGCCTGGCCGATCTCTTCTGTGCCAGCCTCCTCTTCCGCGGCTTCCAG
TTCTTCTTCGACAAGCAGTGGCGCTTGGAGCACCCCAACGTCACTCGCTGGTACGGCAACGTAACGGACCAGCCT
ATTTATGCTGCTGTCGTCCCCAAGACGGAGTATCTTGAGAAGCCGGCTCTGACTAACAAGGCCCCCGAGAAGCCC
TTTGTCGCTAAGTCGTGA
Transcript >Hirsu2|9983
ATGTCCTTCTTCAACTCTGAGATCCTCATCCCCCTAGCCGACTGGTTCCGCCCCCTGGCCGGCAAGGCGCCCTAC
GACAAGCAGTCGGTGGAGAAGTGTTCCCAGGCCACTCTGAAGGCTGTCAAGGTCGTCGAGGAATATCTTCAAGGT
CGCACATTCCTGGTGGGCGAGTCCTTCAGCCTGGCCGATCTCTTCTGTGCCAGCCTCCTCTTCCGCGGCTTCCAG
TTCTTCTTCGACAAGCAGTGGCGCTTGGAGCACCCCAACGTCACTCGCTGGTACGGCAACGTAACGGACCAGCCT
ATTTATGCTGCTGTCGTCCCCAAGACGGAGTATCTTGAGAAGCCGGCTCTGACTAACAAGGCCCCCGAGAAGCCC
TTTGTCGCTAAGTCGTGA
Gene >Hirsu2|9983
ATGTCCTTCTTCAACTCTGAGATCCTCATCCCCCTAGCCGACTGGTTCCGCCCCCTGGCCGGCAAGGCGCCCTAC
GACAAGCAGTCGGTGGAGAAGTGTTCCCAGGCCACTCTGAAGGCTGTCAAGGTCGTCGAGGAATATCTTCAAGGT
CGCACATTCCTGGTGGGCGAGTCCTTCAGCCTGGCCGATCTCTTCTGTGCCAGCCTCCTCTTCCGCGGCTTCCAG
TTCTTCTTCGACAAGCAGTGGCGCTTGGAGCACCCCAACGTCACTCGCTGGTACGGCAACGTAACGGACCAGCCT
ATTTATGCTGCTGTCGTCCCCAAGACGGAGTATCTTGAGAAGCCGGCTCTGACTAACAAGGCCCCCGAGAAGCCC
TTTGTCGCTAAGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail