Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9983
Gene name
LocationContig_77:20265..20658
Strand+
Gene length (bp)393
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00043 GST_C Glutathione S-transferase, C-terminal domain 7.1E-13 19 100
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 4.7E-08 30 93
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 3.6E-06 32 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00717|STCT_EMENI Putative sterigmatocystin biosynthesis protein stcT OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcT PE=4 SV=1 1 105 7.0E-23
sp|P29547|EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAM1 PE=1 SV=2 2 115 6.0E-19
sp|Q90YC0|EF1G_CARAU Elongation factor 1-gamma OS=Carassius auratus GN=eef1g PE=2 SV=1 1 116 7.0E-16
sp|Q6PE25|EF1G_DANRE Elongation factor 1-gamma OS=Danio rerio GN=eef1g PE=2 SV=1 1 116 2.0E-15
sp|B5BP46|YP52_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.02c PE=3 SV=1 1 107 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00717|STCT_EMENI Putative sterigmatocystin biosynthesis protein stcT OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcT PE=4 SV=1 1 105 7.0E-23
sp|P29547|EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAM1 PE=1 SV=2 2 115 6.0E-19
sp|Q90YC0|EF1G_CARAU Elongation factor 1-gamma OS=Carassius auratus GN=eef1g PE=2 SV=1 1 116 7.0E-16
sp|Q6PE25|EF1G_DANRE Elongation factor 1-gamma OS=Danio rerio GN=eef1g PE=2 SV=1 1 116 2.0E-15
sp|B5BP46|YP52_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.02c PE=3 SV=1 1 107 6.0E-15
sp|P26642|EF1GA_XENLA Elongation factor 1-gamma-A OS=Xenopus laevis GN=eef1g-a PE=1 SV=1 1 116 6.0E-14
sp|P26641|EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens GN=EEF1G PE=1 SV=3 1 116 1.0E-13
sp|Q29387|EF1G_PIG Elongation factor 1-gamma (Fragment) OS=Sus scrofa GN=EEF1G PE=2 SV=2 1 116 2.0E-13
sp|Q4R7H5|EF1G_MACFA Elongation factor 1-gamma OS=Macaca fascicularis GN=EEF1G PE=2 SV=1 1 116 4.0E-13
sp|A2Q127|EF1G_HORSE Elongation factor 1-gamma OS=Equus caballus GN=EEF1G PE=2 SV=1 1 116 4.0E-13
sp|Q3SZV3|EF1G_BOVIN Elongation factor 1-gamma OS=Bos taurus GN=EEF1G PE=2 SV=1 1 116 5.0E-13
sp|P29694|EF1G_RABIT Elongation factor 1-gamma OS=Oryctolagus cuniculus GN=EEF1G PE=2 SV=3 1 116 5.0E-13
sp|P12261|EF1G_ARTSA Elongation factor 1-gamma OS=Artemia salina PE=1 SV=3 1 116 5.0E-13
sp|Q68FR6|EF1G_RAT Elongation factor 1-gamma OS=Rattus norvegicus GN=Eef1g PE=2 SV=3 1 116 7.0E-13
sp|Q9D8N0|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3 1 116 7.0E-13
sp|O74830|YC12_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.02 PE=3 SV=1 1 99 2.0E-12
sp|Q91375|EF1GB_XENLA Elongation factor 1-gamma-B OS=Xenopus laevis GN=eef1g-b PE=2 SV=1 1 116 2.0E-12
sp|P42936|YG4D_YEAST Putative elongation factor 1 gamma homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR201C PE=4 SV=3 2 96 3.0E-11
sp|P36008|EF1G2_YEAST Elongation factor 1-gamma 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF4 PE=1 SV=1 2 124 3.0E-11
sp|Q6YW46|EF1G2_ORYSJ Elongation factor 1-gamma 2 OS=Oryza sativa subsp. japonica GN=Os02g0220500 PE=2 SV=2 2 129 2.0E-10
sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 1 114 2.0E-10
sp|P54412|EF1G_CAEEL Probable elongation factor 1-gamma OS=Caenorhabditis elegans GN=eef-1G PE=3 SV=1 1 129 2.0E-10
sp|Q9FVT2|EF1G2_ARATH Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana GN=At1g57720 PE=2 SV=1 1 123 4.0E-10
sp|Q9FUM1|EF1G_PRUAV Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1 1 130 4.0E-10
sp|O04487|EF1G1_ARATH Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana GN=At1g09640 PE=2 SV=1 1 113 8.0E-10
sp|Q9ZRI7|EF1G1_ORYSJ Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1 1 106 7.0E-09
sp|Q9NJH0|EF1G_DROME Elongation factor 1-gamma OS=Drosophila melanogaster GN=Ef1gamma PE=2 SV=2 1 130 9.0E-09
sp|P40921|EF1G_SCHPO Elongation factor 1-gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 2 121 1.0E-07
sp|Q5Z627|EF1G3_ORYSJ Elongation factor 1-gamma 3 OS=Oryza sativa subsp. japonica GN=Os06g0571400 PE=2 SV=1 1 106 1.0E-07
sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens GN=VARS PE=1 SV=4 39 130 2.0E-06
sp|Q04462|SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus GN=Vars PE=2 SV=2 39 106 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9983
MSFFNSEILIPLADWFRPLAGKAPYDKQSVEKCSQATLKAVKVVEEYLQGRTFLVGESFSLADLFCASLLFRGFQ
FFFDKQWRLEHPNVTRWYGNVTDQPIYAAVVPKTEYLEKPALTNKAPEKPFVAKS*
Coding >Hirsu2|9983
ATGTCCTTCTTCAACTCTGAGATCCTCATCCCCCTAGCCGACTGGTTCCGCCCCCTGGCCGGCAAGGCGCCCTAC
GACAAGCAGTCGGTGGAGAAGTGTTCCCAGGCCACTCTGAAGGCTGTCAAGGTCGTCGAGGAATATCTTCAAGGT
CGCACATTCCTGGTGGGCGAGTCCTTCAGCCTGGCCGATCTCTTCTGTGCCAGCCTCCTCTTCCGCGGCTTCCAG
TTCTTCTTCGACAAGCAGTGGCGCTTGGAGCACCCCAACGTCACTCGCTGGTACGGCAACGTAACGGACCAGCCT
ATTTATGCTGCTGTCGTCCCCAAGACGGAGTATCTTGAGAAGCCGGCTCTGACTAACAAGGCCCCCGAGAAGCCC
TTTGTCGCTAAGTCGTGA
Transcript >Hirsu2|9983
ATGTCCTTCTTCAACTCTGAGATCCTCATCCCCCTAGCCGACTGGTTCCGCCCCCTGGCCGGCAAGGCGCCCTAC
GACAAGCAGTCGGTGGAGAAGTGTTCCCAGGCCACTCTGAAGGCTGTCAAGGTCGTCGAGGAATATCTTCAAGGT
CGCACATTCCTGGTGGGCGAGTCCTTCAGCCTGGCCGATCTCTTCTGTGCCAGCCTCCTCTTCCGCGGCTTCCAG
TTCTTCTTCGACAAGCAGTGGCGCTTGGAGCACCCCAACGTCACTCGCTGGTACGGCAACGTAACGGACCAGCCT
ATTTATGCTGCTGTCGTCCCCAAGACGGAGTATCTTGAGAAGCCGGCTCTGACTAACAAGGCCCCCGAGAAGCCC
TTTGTCGCTAAGTCGTGA
Gene >Hirsu2|9983
ATGTCCTTCTTCAACTCTGAGATCCTCATCCCCCTAGCCGACTGGTTCCGCCCCCTGGCCGGCAAGGCGCCCTAC
GACAAGCAGTCGGTGGAGAAGTGTTCCCAGGCCACTCTGAAGGCTGTCAAGGTCGTCGAGGAATATCTTCAAGGT
CGCACATTCCTGGTGGGCGAGTCCTTCAGCCTGGCCGATCTCTTCTGTGCCAGCCTCCTCTTCCGCGGCTTCCAG
TTCTTCTTCGACAAGCAGTGGCGCTTGGAGCACCCCAACGTCACTCGCTGGTACGGCAACGTAACGGACCAGCCT
ATTTATGCTGCTGTCGTCCCCAAGACGGAGTATCTTGAGAAGCCGGCTCTGACTAACAAGGCCCCCGAGAAGCCC
TTTGTCGCTAAGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail