Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9974
Gene name
LocationContig_769:7786..9392
Strand+
Gene length (bp)1606
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12516|SRF1_YEAST Regulator of phospholipase D SRF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRF1 PE=1 SV=1 211 346 2.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 211 233 22
2 248 267 19
3 286 308 22
4 323 345 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9974
MTPDTHGRPSEASSQTASTAALLRLRPPRSLPPWIDSYEERYGPAPEDQLRLLNPPARIVQPQRNATPSEPQRRV
SKDGFVAWDDPQLGPAKDVRAKIPHFLRYGRASMRGRKWDHLRSAEPIIVASHRPATTNPTLAWQEFLHASAWGP
MPNEDSEVVDYDVLRKLQPSFDTKAEVHLNPHDPMASRRRRTVAFYQRLWNGAKRNSLSPLLFRLAVMITSILAL
GIAARIYQHVTTRERDSAERTQSIVAIVVDCVAIPYIGYMIWDEYTGKPVGLRSGNSKTRLILLDLFFIIFKSAS
TALAFESLVYHSHRDHYLHNLSAALGAFELVGLICWTMTFTVNIFRTNFAKRTGVL*
Coding >Hirsu2|9974
ATGACGCCCGATACGCATGGCCGTCCGTCCGAGGCCTCGTCCCAGACGGCCAGCACCGCCGCCCTTTTGCGACTG
CGGCCCCCACGCTCTCTTCCTCCGTGGATCGACTCCTACGAGGAGAGATACGGCCCGGCGCCCGAGGACCAGCTC
CGCCTGCTCAACCCGCCCGCGCGCATCGTCCAGCCCCAGCGCAACGCCACGCCCAGTGAGCCGCAGCGACGGGTG
TCCAAGGATGGCTTCGTCGCCTGGGACGATCCGCAGCTGGGGCCGGCCAAGGACGTCCGCGCCAAGATCCCTCAC
TTTCTGCGCTATGGCCGTGCCTCGATGCGAGGCAGGAAATGGGACCACCTGCGATCCGCCGAGCCCATCATCGTC
GCCAGCCACCGCCCTGCGACGACGAACCCGACCCTGGCCTGGCAGGAGTTTCTGCACGCGTCGGCATGGGGTCCC
ATGCCCAACGAGGACTCCGAGGTCGTCGACTACGACGTCTTGCGGAAGCTGCAGCCGTCCTTCGACACCAAGGCC
GAGGTGCATCTGAACCCCCACGACCCCATGGCGTCGCGTAGGCGGCGCACCGTCGCCTTCTACCAGCGCCTCTGG
AACGGCGCCAAGCGCAACTCGCTGTCGCCCCTGCTCTTTCGCCTGGCCGTCATGATCACGTCCATCCTCGCGCTC
GGCATTGCCGCGCGCATATACCAACACGTGACCACTCGGGAACGCGACAGCGCCGAGCGCACCCAGTCCATCGTC
GCCATTGTCGTCGACTGCGTCGCGATCCCCTACATAGGCTACATGATCTGGGACGAGTACACGGGGAAGCCGGTC
GGCCTCCGGTCCGGAAATTCCAAGACGCGCCTCATCCTGCTCGACCTCTTCTTCATCATCTTCAAGTCGGCCAGC
ACGGCGCTGGCGTTCGAAAGTCTCGTCTACCACAGTCATAGGGACCACTACCTCCACAACCTCTCGGCCGCGCTC
GGGGCCTTCGAGTTGGTTGGCCTGATATGCTGGACCATGACCTTCACCGTCAACATTTTCCGGACCAATTTTGCG
AAACGCACCGGCGTCTTGTGA
Transcript >Hirsu2|9974
ATGACGCCCGATACGCATGGCCGTCCGTCCGAGGCCTCGTCCCAGACGGCCAGCACCGCCGCCCTTTTGCGACTG
CGGCCCCCACGCTCTCTTCCTCCGTGGATCGACTCCTACGAGGAGAGATACGGCCCGGCGCCCGAGGACCAGCTC
CGCCTGCTCAACCCGCCCGCGCGCATCGTCCAGCCCCAGCGCAACGCCACGCCCAGTGAGCCGCAGCGACGGGTG
TCCAAGGATGGCTTCGTCGCCTGGGACGATCCGCAGCTGGGGCCGGCCAAGGACGTCCGCGCCAAGATCCCTCAC
TTTCTGCGCTATGGCCGTGCCTCGATGCGAGGCAGGAAATGGGACCACCTGCGATCCGCCGAGCCCATCATCGTC
GCCAGCCACCGCCCTGCGACGACGAACCCGACCCTGGCCTGGCAGGAGTTTCTGCACGCGTCGGCATGGGGTCCC
ATGCCCAACGAGGACTCCGAGGTCGTCGACTACGACGTCTTGCGGAAGCTGCAGCCGTCCTTCGACACCAAGGCC
GAGGTGCATCTGAACCCCCACGACCCCATGGCGTCGCGTAGGCGGCGCACCGTCGCCTTCTACCAGCGCCTCTGG
AACGGCGCCAAGCGCAACTCGCTGTCGCCCCTGCTCTTTCGCCTGGCCGTCATGATCACGTCCATCCTCGCGCTC
GGCATTGCCGCGCGCATATACCAACACGTGACCACTCGGGAACGCGACAGCGCCGAGCGCACCCAGTCCATCGTC
GCCATTGTCGTCGACTGCGTCGCGATCCCCTACATAGGCTACATGATCTGGGACGAGTACACGGGGAAGCCGGTC
GGCCTCCGGTCCGGAAATTCCAAGACGCGCCTCATCCTGCTCGACCTCTTCTTCATCATCTTCAAGTCGGCCAGC
ACGGCGCTGGCGTTCGAAAGTCTCGTCTACCACAGTCATAGGGACCACTACCTCCACAACCTCTCGGCCGCGCTC
GGGGCCTTCGAGTTGGTTGGCCTGATATGCTGGACCATGACCTTCACCGTCAACATTTTCCGGACCAATTTTGCG
AAACGCACCGGCGTCTTGTGA
Gene >Hirsu2|9974
ATGACGCCCGATACGCATGGCCGTCCGTCCGAGGCCTCGTCCCAGACGGCCAGCACCGCCGCCCTTTTGCGACTG
CGGCCCCCACGCTCTCTTCCTCGTGAGCGCCCTCTCCCGACCTCTGCTTTTCCTTCCACCCTCTTTCCCGACGAC
TTGCTCACCTCCCGTCTCGTGCAGCGTGGATCGACTCCTACGAGGAGAGATACGGCCCGGCGCCCGAGGACCAGC
TCCGCCTGCTCAACCCGCCCGCGCGCATCGTCCAGCCCCAGCGCAACGCCACGCCCAGTGAGCCGCAGCGACGGG
TGTCCAAGGATGGCTTCGTCGCCTGGGACGATCCGCAGCTGGGGCCGGCCAAGGACGTCCGCGCCAAGATCCCTC
ACTTTCTGCGCTATGGCCGTGCCTCGATGCGAGGCAGGAAATGGGACCACCTGCGATCCGCCGAGCCCATCATCG
TCGCCAGCCACCGCCCTGCGACGACGAACCCGACCCTGGCCTGGCAGGAGTTTCTGCACGCGTCGGCATGGGGTC
CCATGCCCAACGAGGACTCCGAGGTCGTCGACTACGACGTCTTGCGGAAGCTGCAGCCGTCCTTCGACACCAAGG
CCGAGGTGCATCTGAACCCCCACGACCCCATGGCGTCGCGTAGGCGGCGCACCGTCGCCTTCTACCAGCGCCTCT
GGAACGGCGCCAAGCGCAACTCGCTGTCGCCCCTGCTCTTTCGCCTGGCCGTCATGATCACGTCCATCCTCGCGC
TCGGCATTGCCGCGCGCATATACCAACACGTGACCACTCGGGAACGCGACAGCGCCGAGCGCACCCAGTCCATCG
TCGCCATTGTCGTCGACTGCGTCGCGATCCCCTACATAGGCTACATGATCTGGGACGAGTACACGGGGAAGCCGG
TCGGCCTCCGGTCCGGAAATTCCAAGACGCGCCTCATCCTGCTCGACCTCTTCTTCATCATCTTCAAGTCGGCCA
GCACGGCGCTGGCGTTCGAAAGTCTCGTCTACCACAGTCATAGGGACCACTACCTCCACAACCTCTCGGCCGCGC
TCGGGGCCTTCGAGTTGGTTGGCCTGATATGCTGGACCATGACCTTCACCGTCAACATTTTCCGGACCGTCGAGC
GGCTCGGCGGCGGCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGGGG
GGGGGGGGATGGGGGCGTCTTTGACTATCGGGCCGTCGGCCAGGGAGCCGTGCAGGAGTGCCAGGGAGGGAGATG
CCGCCCTCGGGGCGGATCCAAGGGGGAAAGACGGAACGCAACTACCGCGTTGTATGTGTCTTAACGATGTTACGA
TGGCGTCCCGCTTACATCTCCATGTCTCAAACACACGCGTATGTACTCTAGACAGCACGGCATACCTACCCTACA
TCAAACGACAGGTCTCTGGGGGTTCGTTGAGGTGACAAGCAAGGCGCGGGAATCGGTGCATGTTTCAGTCGATGA
AATAACCTGTTGTGTGCTTTTTCCGTGCCGCGATGATCCGACCCCTGTGCGAGGACTTCTGCCACGACTTGCGTA
GAATTTTGCGAAACGCACCGGCGTCTTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail