Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9971
Gene name
LocationContig_769:529..2482
Strand-
Gene length (bp)1953
Transcript length (bp)1953
Coding sequence length (bp)1953
Protein length (aa) 651

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01485 IBR IBR domain, a half RING-finger domain 5.8E-06 499 544

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P58283|RN216_MOUSE E3 ubiquitin-protein ligase RNF216 OS=Mus musculus GN=Rnf216 PE=1 SV=3 462 575 4.0E-22
sp|Q9NWF9|RN216_HUMAN E3 ubiquitin-protein ligase RNF216 OS=Homo sapiens GN=RNF216 PE=1 SV=3 462 575 2.0E-21
sp|Q9NWF9|RN216_HUMAN E3 ubiquitin-protein ligase RNF216 OS=Homo sapiens GN=RNF216 PE=1 SV=3 212 344 5.0E-07
sp|P58283|RN216_MOUSE E3 ubiquitin-protein ligase RNF216 OS=Mus musculus GN=Rnf216 PE=1 SV=3 212 344 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 413 435 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9971
MVFSGLLSSSDRPSPSSRPKSSAEPGPDPRPDLIHDEAQLPCVPPERPNLRDLNNSLEALAAVFPDIQIEVFREL
LSKFDGESRLALVAEALLKNRVAWVKGRWRSVADQQTDQQTAPSLPRGDVFRSQEYVKAARSLAWHEFRGLPRST
INAVLAESNHAYLDARRTLVALSSKSWRFTISSLFLRRKPVATAESQQHPLVVWRPLGPAGALVPAVRATGSAEL
DRELYDALVRPLQERDRADRETTDRSLALRLNNDEAEEAGATHECTCCFVAAAFEDFTSCNRHGHMVCHRCVQHA
TKEALFGQAWLASVNLDTGTLKCLAMEADGCSGYIPSDHLHRALIGDRAGADMLHKLDQRLAEHSLVASKLPLIH
CPFCTYIEVDDICVPDPDDNGPRLRADSASALLLLALVAALLVLYLPIALFSSLVCVVLCSDRTLSQRLRAEWDR
ALARQHRRRRGQRFRCQNPRCGRVSCLSCHKPWADIHVCHESSLVALRTQVEQAMSMAIKRVCPRCNTSFVKNAG
CNKLTCPCGYKMCYVCRADLSDDGYRHFCDHFRPDGDPRPCRECDRCNLWESEDVDRVLQEAREEAERRWKAKEK
RELSGAEKAYLETGVARRRTAGFSVPRVLGGAGMPTLAGLLDSVVDVLFI*
Coding >Hirsu2|9971
ATGGTCTTCTCCGGCCTGCTCTCCTCCAGCGATAGGCCGTCGCCCTCGAGCCGCCCAAAATCGAGCGCCGAGCCC
GGCCCCGACCCGCGCCCCGACCTGATCCACGACGAGGCCCAGCTGCCGTGCGTCCCGCCCGAGCGGCCCAACCTG
CGCGACCTCAACAACAGCCTCGAGGCCCTGGCGGCCGTCTTCCCGGACATCCAGATCGAGGTCTTCCGCGAGCTG
CTGTCCAAGTTCGATGGCGAGTCCAGGCTGGCCCTCGTGGCCGAGGCGCTGCTCAAGAACCGCGTCGCCTGGGTC
AAGGGCAGGTGGAGGAGCGTGGCGGACCAGCAGACGGACCAGCAGACGGCGCCGTCGCTGCCTCGGGGCGACGTC
TTCCGCAGCCAGGAGTACGTCAAGGCCGCCCGCTCGCTGGCCTGGCACGAGTTCAGGGGCCTGCCGCGCTCCACC
ATCAACGCCGTCCTGGCCGAGTCCAACCACGCGTACCTCGACGCCCGCCGCACCCTCGTCGCGCTCTCGTCCAAG
TCGTGGCGCTTCACCATCTCCTCGCTCTTCCTGCGCCGCAAGCCCGTCGCCACGGCCGAGTCCCAGCAGCACCCG
CTCGTCGTCTGGCGGCCCCTCGGCCCCGCCGGCGCCCTCGTCCCGGCCGTCCGCGCCACCGGCAGCGCCGAGCTG
GACCGCGAGCTGTACGACGCCCTCGTCCGCCCCCTGCAGGAGAGGGACCGGGCCGACCGGGAGACGACGGACCGC
AGCCTGGCCCTGCGCCTGAACAACGACGAGGCCGAGGAGGCCGGCGCGACGCACGAGTGCACCTGCTGCTTCGTC
GCCGCCGCCTTCGAGGACTTCACCAGCTGCAACCGCCACGGACACATGGTCTGCCACCGCTGCGTCCAGCACGCC
ACCAAGGAGGCCCTCTTCGGCCAGGCCTGGCTCGCCAGCGTCAACCTCGACACCGGCACCCTCAAGTGCCTCGCC
ATGGAGGCCGACGGCTGCTCCGGCTACATCCCCTCGGACCACCTGCACCGCGCCCTCATCGGCGACCGGGCCGGC
GCCGACATGCTGCACAAGCTGGACCAGCGGCTGGCCGAGCACAGCCTGGTCGCCTCCAAGCTGCCCCTCATCCAC
TGCCCCTTCTGCACCTACATCGAGGTCGACGACATCTGCGTGCCGGACCCGGACGACAACGGGCCCCGGCTCCGG
GCCGACAGCGCCTCGGCCCTGCTGCTGCTCGCCCTCGTCGCCGCCCTGCTCGTCCTCTACCTGCCCATCGCCCTC
TTCTCCTCGCTCGTCTGCGTCGTGCTCTGCTCGGACCGCACCCTCTCGCAGCGGCTGCGCGCCGAGTGGGACAGG
GCGCTGGCCCGGCAGCACCGCCGGCGCCGCGGCCAGCGCTTCCGCTGCCAGAACCCGCGGTGCGGGCGCGTGTCG
TGCCTGTCGTGCCACAAGCCGTGGGCCGACATACACGTGTGCCACGAGTCGTCGCTCGTCGCGCTGCGGACGCAG
GTCGAGCAGGCCATGAGCATGGCCATCAAGCGCGTCTGCCCGCGCTGCAACACGTCCTTCGTCAAGAACGCCGGC
TGCAACAAGCTGACGTGCCCGTGCGGCTACAAGATGTGCTACGTGTGCCGGGCCGACCTGAGCGACGACGGCTAC
CGGCACTTCTGCGACCACTTCCGGCCGGACGGCGACCCGCGGCCGTGCCGCGAGTGCGACCGCTGCAACCTGTGG
GAGTCGGAGGACGTCGACCGCGTCCTGCAGGAGGCGCGCGAGGAGGCGGAGCGCCGCTGGAAGGCCAAGGAGAAG
CGCGAGCTGTCGGGCGCCGAGAAGGCCTACCTCGAGACGGGCGTCGCCCGGCGCCGGACGGCCGGCTTCAGCGTC
CCGCGCGTGCTGGGCGGCGCCGGCATGCCCACCCTGGCCGGCCTGCTCGACTCCGTCGTCGATGTCCTGTTTATC
TGA
Transcript >Hirsu2|9971
ATGGTCTTCTCCGGCCTGCTCTCCTCCAGCGATAGGCCGTCGCCCTCGAGCCGCCCAAAATCGAGCGCCGAGCCC
GGCCCCGACCCGCGCCCCGACCTGATCCACGACGAGGCCCAGCTGCCGTGCGTCCCGCCCGAGCGGCCCAACCTG
CGCGACCTCAACAACAGCCTCGAGGCCCTGGCGGCCGTCTTCCCGGACATCCAGATCGAGGTCTTCCGCGAGCTG
CTGTCCAAGTTCGATGGCGAGTCCAGGCTGGCCCTCGTGGCCGAGGCGCTGCTCAAGAACCGCGTCGCCTGGGTC
AAGGGCAGGTGGAGGAGCGTGGCGGACCAGCAGACGGACCAGCAGACGGCGCCGTCGCTGCCTCGGGGCGACGTC
TTCCGCAGCCAGGAGTACGTCAAGGCCGCCCGCTCGCTGGCCTGGCACGAGTTCAGGGGCCTGCCGCGCTCCACC
ATCAACGCCGTCCTGGCCGAGTCCAACCACGCGTACCTCGACGCCCGCCGCACCCTCGTCGCGCTCTCGTCCAAG
TCGTGGCGCTTCACCATCTCCTCGCTCTTCCTGCGCCGCAAGCCCGTCGCCACGGCCGAGTCCCAGCAGCACCCG
CTCGTCGTCTGGCGGCCCCTCGGCCCCGCCGGCGCCCTCGTCCCGGCCGTCCGCGCCACCGGCAGCGCCGAGCTG
GACCGCGAGCTGTACGACGCCCTCGTCCGCCCCCTGCAGGAGAGGGACCGGGCCGACCGGGAGACGACGGACCGC
AGCCTGGCCCTGCGCCTGAACAACGACGAGGCCGAGGAGGCCGGCGCGACGCACGAGTGCACCTGCTGCTTCGTC
GCCGCCGCCTTCGAGGACTTCACCAGCTGCAACCGCCACGGACACATGGTCTGCCACCGCTGCGTCCAGCACGCC
ACCAAGGAGGCCCTCTTCGGCCAGGCCTGGCTCGCCAGCGTCAACCTCGACACCGGCACCCTCAAGTGCCTCGCC
ATGGAGGCCGACGGCTGCTCCGGCTACATCCCCTCGGACCACCTGCACCGCGCCCTCATCGGCGACCGGGCCGGC
GCCGACATGCTGCACAAGCTGGACCAGCGGCTGGCCGAGCACAGCCTGGTCGCCTCCAAGCTGCCCCTCATCCAC
TGCCCCTTCTGCACCTACATCGAGGTCGACGACATCTGCGTGCCGGACCCGGACGACAACGGGCCCCGGCTCCGG
GCCGACAGCGCCTCGGCCCTGCTGCTGCTCGCCCTCGTCGCCGCCCTGCTCGTCCTCTACCTGCCCATCGCCCTC
TTCTCCTCGCTCGTCTGCGTCGTGCTCTGCTCGGACCGCACCCTCTCGCAGCGGCTGCGCGCCGAGTGGGACAGG
GCGCTGGCCCGGCAGCACCGCCGGCGCCGCGGCCAGCGCTTCCGCTGCCAGAACCCGCGGTGCGGGCGCGTGTCG
TGCCTGTCGTGCCACAAGCCGTGGGCCGACATACACGTGTGCCACGAGTCGTCGCTCGTCGCGCTGCGGACGCAG
GTCGAGCAGGCCATGAGCATGGCCATCAAGCGCGTCTGCCCGCGCTGCAACACGTCCTTCGTCAAGAACGCCGGC
TGCAACAAGCTGACGTGCCCGTGCGGCTACAAGATGTGCTACGTGTGCCGGGCCGACCTGAGCGACGACGGCTAC
CGGCACTTCTGCGACCACTTCCGGCCGGACGGCGACCCGCGGCCGTGCCGCGAGTGCGACCGCTGCAACCTGTGG
GAGTCGGAGGACGTCGACCGCGTCCTGCAGGAGGCGCGCGAGGAGGCGGAGCGCCGCTGGAAGGCCAAGGAGAAG
CGCGAGCTGTCGGGCGCCGAGAAGGCCTACCTCGAGACGGGCGTCGCCCGGCGCCGGACGGCCGGCTTCAGCGTC
CCGCGCGTGCTGGGCGGCGCCGGCATGCCCACCCTGGCCGGCCTGCTCGACTCCGTCGTCGATGTCCTGTTTATC
TGA
Gene >Hirsu2|9971
ATGGTCTTCTCCGGCCTGCTCTCCTCCAGCGATAGGCCGTCGCCCTCGAGCCGCCCAAAATCGAGCGCCGAGCCC
GGCCCCGACCCGCGCCCCGACCTGATCCACGACGAGGCCCAGCTGCCGTGCGTCCCGCCCGAGCGGCCCAACCTG
CGCGACCTCAACAACAGCCTCGAGGCCCTGGCGGCCGTCTTCCCGGACATCCAGATCGAGGTCTTCCGCGAGCTG
CTGTCCAAGTTCGATGGCGAGTCCAGGCTGGCCCTCGTGGCCGAGGCGCTGCTCAAGAACCGCGTCGCCTGGGTC
AAGGGCAGGTGGAGGAGCGTGGCGGACCAGCAGACGGACCAGCAGACGGCGCCGTCGCTGCCTCGGGGCGACGTC
TTCCGCAGCCAGGAGTACGTCAAGGCCGCCCGCTCGCTGGCCTGGCACGAGTTCAGGGGCCTGCCGCGCTCCACC
ATCAACGCCGTCCTGGCCGAGTCCAACCACGCGTACCTCGACGCCCGCCGCACCCTCGTCGCGCTCTCGTCCAAG
TCGTGGCGCTTCACCATCTCCTCGCTCTTCCTGCGCCGCAAGCCCGTCGCCACGGCCGAGTCCCAGCAGCACCCG
CTCGTCGTCTGGCGGCCCCTCGGCCCCGCCGGCGCCCTCGTCCCGGCCGTCCGCGCCACCGGCAGCGCCGAGCTG
GACCGCGAGCTGTACGACGCCCTCGTCCGCCCCCTGCAGGAGAGGGACCGGGCCGACCGGGAGACGACGGACCGC
AGCCTGGCCCTGCGCCTGAACAACGACGAGGCCGAGGAGGCCGGCGCGACGCACGAGTGCACCTGCTGCTTCGTC
GCCGCCGCCTTCGAGGACTTCACCAGCTGCAACCGCCACGGACACATGGTCTGCCACCGCTGCGTCCAGCACGCC
ACCAAGGAGGCCCTCTTCGGCCAGGCCTGGCTCGCCAGCGTCAACCTCGACACCGGCACCCTCAAGTGCCTCGCC
ATGGAGGCCGACGGCTGCTCCGGCTACATCCCCTCGGACCACCTGCACCGCGCCCTCATCGGCGACCGGGCCGGC
GCCGACATGCTGCACAAGCTGGACCAGCGGCTGGCCGAGCACAGCCTGGTCGCCTCCAAGCTGCCCCTCATCCAC
TGCCCCTTCTGCACCTACATCGAGGTCGACGACATCTGCGTGCCGGACCCGGACGACAACGGGCCCCGGCTCCGG
GCCGACAGCGCCTCGGCCCTGCTGCTGCTCGCCCTCGTCGCCGCCCTGCTCGTCCTCTACCTGCCCATCGCCCTC
TTCTCCTCGCTCGTCTGCGTCGTGCTCTGCTCGGACCGCACCCTCTCGCAGCGGCTGCGCGCCGAGTGGGACAGG
GCGCTGGCCCGGCAGCACCGCCGGCGCCGCGGCCAGCGCTTCCGCTGCCAGAACCCGCGGTGCGGGCGCGTGTCG
TGCCTGTCGTGCCACAAGCCGTGGGCCGACATACACGTGTGCCACGAGTCGTCGCTCGTCGCGCTGCGGACGCAG
GTCGAGCAGGCCATGAGCATGGCCATCAAGCGCGTCTGCCCGCGCTGCAACACGTCCTTCGTCAAGAACGCCGGC
TGCAACAAGCTGACGTGCCCGTGCGGCTACAAGATGTGCTACGTGTGCCGGGCCGACCTGAGCGACGACGGCTAC
CGGCACTTCTGCGACCACTTCCGGCCGGACGGCGACCCGCGGCCGTGCCGCGAGTGCGACCGCTGCAACCTGTGG
GAGTCGGAGGACGTCGACCGCGTCCTGCAGGAGGCGCGCGAGGAGGCGGAGCGCCGCTGGAAGGCCAAGGAGAAG
CGCGAGCTGTCGGGCGCCGAGAAGGCCTACCTCGAGACGGGCGTCGCCCGGCGCCGGACGGCCGGCTTCAGCGTC
CCGCGCGTGCTGGGCGGCGCCGGCATGCCCACCCTGGCCGGCCTGCTCGACTCCGTCGTCGATGTCCTGTTTATC
TGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail