Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9969
Gene name
LocationContig_768:8695..9244
Strand+
Gene length (bp)549
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5132 0.6836 0.0692 0.078 0.3101 0.0042 0.0647 0.1962 0.1556 0.3673

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup330
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|473
Ophiocordyceps australis 1348a (Ghana) OphauG2|5753
Ophiocordyceps australis map64 (Brazil) OphauB2|1217
Ophiocordyceps australis map64 (Brazil) OphauB2|3178
Ophiocordyceps camponoti-floridani Ophcf2|06621
Ophiocordyceps camponoti-rufipedis Ophun1|7420
Ophiocordyceps subramaniannii Hirsu2|3507
Ophiocordyceps subramaniannii Hirsu2|9814
Ophiocordyceps subramaniannii Hirsu2|9968
Ophiocordyceps subramaniannii Hirsu2|9969 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9969
MTLFEPFLNHNLSTDLDPGPSPRMAFYTASKFLQTLLRLYYLRHGFESTDVFLTQPLARAGFMCLDAIQELPPGD
RLEAARSTLFLAAKGLYDQGQSHRLAKTLFLVVSRRMRPEEEVLMREIPSLTDGQDHGGQAETPVVHSKWPVDTT
RKTVDIESKTLTSLVKQLDISSPAVDIKAGGR*
Coding >Hirsu2|9969
ATGACGCTCTTCGAGCCGTTTCTCAACCACAATCTCTCGACCGACTTGGACCCGGGCCCCAGCCCACGGATGGCC
TTTTATACGGCCAGTAAGTTCCTGCAGACGCTCCTCCGCCTCTACTACCTGCGGCACGGGTTCGAGTCGACAGAC
GTCTTCCTGACGCAGCCGCTGGCCCGCGCCGGCTTCATGTGCCTCGATGCCATCCAAGAGCTCCCCCCCGGCGAC
CGGCTGGAGGCGGCTCGTTCCACGCTGTTCCTTGCCGCCAAAGGCCTGTACGATCAGGGCCAGAGTCATAGGCTG
GCCAAGACGCTGTTCCTCGTCGTCAGTCGCCGCATGCGGCCCGAGGAAGAGGTGCTGATGAGGGAGATTCCGAGC
CTCACAGACGGTCAGGACCACGGGGGCCAGGCGGAGACTCCAGTGGTCCATAGCAAGTGGCCGGTCGATACCACT
CGCAAGACTGTCGACATCGAGTCCAAGACGTTGACGAGTCTGGTCAAGCAGCTCGACATCTCGAGCCCGGCGGTC
GACATAAAGGCCGGTGGTCGCTGA
Transcript >Hirsu2|9969
ATGACGCTCTTCGAGCCGTTTCTCAACCACAATCTCTCGACCGACTTGGACCCGGGCCCCAGCCCACGGATGGCC
TTTTATACGGCCAGTAAGTTCCTGCAGACGCTCCTCCGCCTCTACTACCTGCGGCACGGGTTCGAGTCGACAGAC
GTCTTCCTGACGCAGCCGCTGGCCCGCGCCGGCTTCATGTGCCTCGATGCCATCCAAGAGCTCCCCCCCGGCGAC
CGGCTGGAGGCGGCTCGTTCCACGCTGTTCCTTGCCGCCAAAGGCCTGTACGATCAGGGCCAGAGTCATAGGCTG
GCCAAGACGCTGTTCCTCGTCGTCAGTCGCCGCATGCGGCCCGAGGAAGAGGTGCTGATGAGGGAGATTCCGAGC
CTCACAGACGGTCAGGACCACGGGGGCCAGGCGGAGACTCCAGTGGTCCATAGCAAGTGGCCGGTCGATACCACT
CGCAAGACTGTCGACATCGAGTCCAAGACGTTGACGAGTCTGGTCAAGCAGCTCGACATCTCGAGCCCGGCGGTC
GACATAAAGGCCGGTGGTCGCTGA
Gene >Hirsu2|9969
ATGACGCTCTTCGAGCCGTTTCTCAACCACAATCTCTCGACCGACTTGGACCCGGGCCCCAGCCCACGGATGGCC
TTTTATACGGCCAGTAAGTTCCTGCAGACGCTCCTCCGCCTCTACTACCTGCGGCACGGGTTCGAGTCGACAGAC
GTCTTCCTGACGCAGCCGCTGGCCCGCGCCGGCTTCATGTGCCTCGATGCCATCCAAGAGCTCCCCCCCGGCGAC
CGGCTGGAGGCGGCTCGTTCCACGCTGTTCCTTGCCGCCAAAGGCCTGTACGATCAGGGCCAGAGTCATAGGCTG
GCCAAGACGCTGTTCCTCGTCGTCAGTCGCCGCATGCGGCCCGAGGAAGAGGTGCTGATGAGGGAGATTCCGAGC
CTCACAGACGGTCAGGACCACGGGGGCCAGGCGGAGACTCCAGTGGTCCATAGCAAGTGGCCGGTCGATACCACT
CGCAAGACTGTCGACATCGAGTCCAAGACGTTGACGAGTCTGGTCAAGCAGCTCGACATCTCGAGCCCGGCGGTC
GACATAAAGGCCGGTGGTCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail