Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9968
Gene name
LocationContig_768:6982..8113
Strand+
Gene length (bp)1131
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 184 346 1.0E-08
sp|P28349|NIT4_NEUCR Nitrogen assimilation transcription factor nit-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-4 PE=3 SV=2 18 346 4.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal|Nuclear export signal 0.4691 0.6965 0.1216 0.1076 0.0406 0.0158 0.0637 0.0719 0.1343 0.0277

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup330
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|473
Ophiocordyceps australis 1348a (Ghana) OphauG2|5753
Ophiocordyceps australis map64 (Brazil) OphauB2|1217
Ophiocordyceps australis map64 (Brazil) OphauB2|3178
Ophiocordyceps camponoti-floridani Ophcf2|06621
Ophiocordyceps camponoti-rufipedis Ophun1|7420
Ophiocordyceps subramaniannii Hirsu2|3507
Ophiocordyceps subramaniannii Hirsu2|9814
Ophiocordyceps subramaniannii Hirsu2|9968 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9969

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9968
MCQWGTEHSETHSQALKRRYSVMEKQNAAKVEHIAAMEDILYRIKTRSEPEALEIFRRLRSHTDVATTLSLITSG
DTLLQLLLVPETRRRYEFPYINRMPAGLVADNPYLDSLIYSAATLYDGDDADDGDGASRRAQQHAVRCQGVAMLV
DKFGKAEHESLYLKPFHAADLAEPRLSKTKPSAWTSVCDDDAFMNGLLAAWFRSEYSSQSPVHKNFFLEDMASQR
STFCSSLLVNAVLAYACICSRLPDRPEYRNPHSYSYRFLVEAKRIWELEAIRPCITTIQAGIILNLVHNLDGLDE
IGRAYGEHSVTLASALGLFGGAVEEVRSKRDRDGRAFTAWALFSFET*
Coding >Hirsu2|9968
ATGTGCCAGTGGGGCACGGAACACTCCGAGACGCATTCGCAGGCGCTCAAGCGCCGCTACAGCGTCATGGAGAAG
CAGAACGCCGCCAAGGTGGAGCACATCGCCGCCATGGAAGATATCCTGTACCGCATCAAGACGCGGTCAGAGCCC
GAGGCCCTGGAGATCTTCCGCCGGCTCCGATCGCACACCGACGTCGCCACTACCCTGAGCCTCATCACCTCGGGC
GACACGCTGCTGCAGCTGTTGCTCGTGCCGGAGACGCGCCGCCGCTACGAGTTCCCCTATATTAATCGCATGCCG
GCCGGCCTCGTGGCCGACAATCCATACCTCGACTCGCTCATCTATTCGGCCGCCACGCTCTACGACGGTGACGAT
GCCGACGACGGCGATGGCGCTTCCCGACGGGCTCAGCAGCACGCTGTCAGGTGCCAGGGGGTCGCCATGCTCGTC
GACAAGTTCGGCAAGGCCGAGCACGAGAGTCTTTATCTCAAGCCCTTCCACGCTGCCGATCTGGCCGAGCCGCGC
CTCTCCAAGACCAAGCCGTCGGCCTGGACATCTGTCTGTGACGACGATGCCTTTATGAATGGCCTGCTAGCTGCC
TGGTTCCGCTCCGAGTACAGCTCTCAGAGCCCCGTCCACAAGAACTTCTTCCTCGAGGACATGGCTTCTCAGCGC
AGCACCTTCTGCTCATCGTTGCTCGTCAACGCTGTTTTAGCATACGCCTGTATCTGCTCCCGCCTCCCCGACCGC
CCCGAATACCGAAACCCTCACTCGTATTCGTACCGCTTCCTCGTCGAGGCGAAGCGAATTTGGGAGCTCGAGGCT
ATCAGGCCCTGCATCACCACCATCCAGGCCGGCATCATCCTCAACCTCGTCCACAACCTCGACGGCCTCGACGAG
ATCGGACGCGCCTACGGCGAACACTCCGTCACCCTGGCCAGTGCCCTGGGCCTGTTCGGCGGCGCCGTCGAAGAG
GTCCGCTCCAAGCGTGACAGAGACGGGCGAGCCTTTACGGCTTGGGCCTTGTTCAGTTTCGAGACGTGA
Transcript >Hirsu2|9968
ATGTGCCAGTGGGGCACGGAACACTCCGAGACGCATTCGCAGGCGCTCAAGCGCCGCTACAGCGTCATGGAGAAG
CAGAACGCCGCCAAGGTGGAGCACATCGCCGCCATGGAAGATATCCTGTACCGCATCAAGACGCGGTCAGAGCCC
GAGGCCCTGGAGATCTTCCGCCGGCTCCGATCGCACACCGACGTCGCCACTACCCTGAGCCTCATCACCTCGGGC
GACACGCTGCTGCAGCTGTTGCTCGTGCCGGAGACGCGCCGCCGCTACGAGTTCCCCTATATTAATCGCATGCCG
GCCGGCCTCGTGGCCGACAATCCATACCTCGACTCGCTCATCTATTCGGCCGCCACGCTCTACGACGGTGACGAT
GCCGACGACGGCGATGGCGCTTCCCGACGGGCTCAGCAGCACGCTGTCAGGTGCCAGGGGGTCGCCATGCTCGTC
GACAAGTTCGGCAAGGCCGAGCACGAGAGTCTTTATCTCAAGCCCTTCCACGCTGCCGATCTGGCCGAGCCGCGC
CTCTCCAAGACCAAGCCGTCGGCCTGGACATCTGTCTGTGACGACGATGCCTTTATGAATGGCCTGCTAGCTGCC
TGGTTCCGCTCCGAGTACAGCTCTCAGAGCCCCGTCCACAAGAACTTCTTCCTCGAGGACATGGCTTCTCAGCGC
AGCACCTTCTGCTCATCGTTGCTCGTCAACGCTGTTTTAGCATACGCCTGTATCTGCTCCCGCCTCCCCGACCGC
CCCGAATACCGAAACCCTCACTCGTATTCGTACCGCTTCCTCGTCGAGGCGAAGCGAATTTGGGAGCTCGAGGCT
ATCAGGCCCTGCATCACCACCATCCAGGCCGGCATCATCCTCAACCTCGTCCACAACCTCGACGGCCTCGACGAG
ATCGGACGCGCCTACGGCGAACACTCCGTCACCCTGGCCAGTGCCCTGGGCCTGTTCGGCGGCGCCGTCGAAGAG
GTCCGCTCCAAGCGTGACAGAGACGGGCGAGCCTTTACGGCTTGGGCCTTGTTCAGTTTCGAGACGTGA
Gene >Hirsu2|9968
ATGTGCCAGTGGGGCACGGAACACTCCGAGACGCATTCGCAGGCGCTCAAGCGCCGCTACAGCGTCATGGAGAAG
CAGAACGCCGCCAAGGTGGAGCACATCGCCGCCATGGAAGATATCCTGTACCGCATCAAGACGCGGTCAGAGCCC
GAGGCCCTGGAGATCTTCCGCCGGCTCCGATCGCACACCGACGTCGCCACTACCCTGAGCCTCATCACCTCGGGC
GACACGCTGCTGCAGCTGTTGCTCGTGCCGGAGACGCGCCGCCGCTACGAGTTCCCCTATATTAATCGCATGCCG
GCCGGCCTCGTGGCCGACAATCCATACCTCGACTCGCTCATCTATTCGGCCGCCACGCTCTACGACGGTGACGAT
GCCGACGACGGCGATGGCGCTTCCCGACGGGCTCAGCAGCACGCTGTCAGGTGCCAGGGGGTCGCCATGCTCGTC
GACAAGTTCGGCAAGGCCGAGCACGAGAGTCTTTATCTCAAGCCCTTCCACGCTGCCGATCTGGCCGAGCCGCGC
CTCTCCAAGACCAAGCCGTCGGCCTGGACATCTGTCTGTGACGACGATGCCTTTATGAATGGCCTGCTAGCTGCC
TGGTTCCGCTCCGAGTACAGCTCTCAGAGCCCCGTCCACAAGAACTTCTTCCTCGAGGACATGGCTTCTCAGCGC
AGCACCTTCTGCTCATCGTTGCTCGTCAACGCTGTTTTAGCATACGCCTGTGTACGAGCAGTGCCGCTCCCCTTC
TCGCCCGGACGCTAGGCTTGAACGGACCGGCATTATGGCTCGCTGACCTTGTCTGCCTCCCAGATCTGCTCCCGC
CTCCCCGACCGCCCCGAATACCGAAACCCTCACTCGTATTCGTACCGCTTCCTCGTCGAGGCGAAGCGAATTTGG
GAGCTCGAGGCTATCAGGCCCTGCATCACCACCATCCAGGCCGGCATCATCCTCAACCTCGTCCACAACCTCGAC
GGCCTCGACGAGATCGGACGCGCCTACGGCGAACACTCCGTCACCCTGGCCAGTGCCCTGGGCCTGTTCGGCGGC
GCCGTCGAAGAGGTCCGCTCCAAGCGTGACAGAGACGGGCGAGCCTTTACGGCTTGGGCCTTGTTCAGTTTCGAG
ACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail