Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9956
Gene name
LocationContig_766:1086..4548
Strand-
Gene length (bp)3462
Transcript length (bp)3387
Coding sequence length (bp)3387
Protein length (aa) 1129

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 2.1E-07 69 135
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 1.8E-25 225 798
PF09334 tRNA-synt_1g tRNA synthetases class I (M) 4.2E-09 719 802
PF08264 Anticodon_1 Anticodon-binding domain of tRNA 1.2E-11 841 962
PF01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain 3.3E-07 712 788

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10857|SYLC_NEUCR Leucine--tRNA ligase, cytoplasmic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-6 PE=3 SV=2 1 1126 0.0E+00
sp|Q10490|SYLC_SCHPO Putative leucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lrs1 PE=1 SV=1 5 1128 0.0E+00
sp|P26637|SYLC_YEAST Leucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC60 PE=1 SV=1 24 1126 0.0E+00
sp|Q5R614|SYLC_PONAB Leucine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=LARS PE=2 SV=1 23 1117 0.0E+00
sp|Q8BMJ2|SYLC_MOUSE Leucine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Lars PE=1 SV=2 25 1120 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10857|SYLC_NEUCR Leucine--tRNA ligase, cytoplasmic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-6 PE=3 SV=2 1 1126 0.0E+00
sp|Q10490|SYLC_SCHPO Putative leucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lrs1 PE=1 SV=1 5 1128 0.0E+00
sp|P26637|SYLC_YEAST Leucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC60 PE=1 SV=1 24 1126 0.0E+00
sp|Q5R614|SYLC_PONAB Leucine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=LARS PE=2 SV=1 23 1117 0.0E+00
sp|Q8BMJ2|SYLC_MOUSE Leucine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Lars PE=1 SV=2 25 1120 0.0E+00
sp|Q9P2J5|SYLC_HUMAN Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=LARS PE=1 SV=2 23 1117 0.0E+00
sp|Q09996|SYLC_CAEEL Leucine--tRNA ligase OS=Caenorhabditis elegans GN=lrs-1 PE=3 SV=2 25 1123 0.0E+00
sp|Q54N83|SYLC_DICDI Leucine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=leuS PE=3 SV=1 26 1121 0.0E+00
sp|F4I116|SYLC_ARATH Leucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At1g09620 PE=1 SV=1 23 1120 0.0E+00
sp|Q9YD97|SYL_AERPE Leucine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=leuS PE=3 SV=1 31 1128 4.0E-143
sp|Q9V0B9|SYL_PYRAB Leucine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuS PE=3 SV=1 35 935 1.0E-134
sp|O58698|SYL_PYRHO Leucine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=leuS PE=1 SV=1 35 1042 6.0E-134
sp|Q8U2E6|SYL_PYRFU Leucine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuS PE=3 SV=1 35 1029 2.0E-131
sp|B6YST9|SYL_THEON Leucine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=leuS PE=3 SV=1 35 1044 1.0E-128
sp|Q8NKR7|SYL_THEKO Leucine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=leuS PE=3 SV=2 35 1044 8.0E-128
sp|O30250|SYL_ARCFU Leucine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuS PE=3 SV=1 36 1065 9.0E-125
sp|A3DKS1|SYL_STAMF Leucine--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=leuS PE=3 SV=1 28 1023 2.0E-124
sp|A0B7B7|SYL_METTP Leucine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=leuS PE=3 SV=1 36 1124 4.0E-124
sp|Q8TVM4|SYL_METKA Leucine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuS PE=3 SV=1 78 1003 9.0E-121
sp|Q6LZD2|SYL_METMP Leucine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=leuS PE=3 SV=1 29 992 1.0E-119
sp|A6VK04|SYL_METM7 Leucine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=leuS PE=3 SV=1 29 992 2.0E-119
sp|A4FYA3|SYL_METM5 Leucine--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=leuS PE=3 SV=1 29 992 2.0E-119
sp|A6USJ5|SYL_METVS Leucine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=leuS PE=3 SV=1 29 1072 1.0E-118
sp|A6UTK3|SYL_META3 Leucine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=leuS PE=3 SV=1 32 953 2.0E-118
sp|O27552|SYL_METTH Leucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuS PE=1 SV=1 36 1061 5.0E-118
sp|A4YI28|SYL2_METS5 Leucine--tRNA ligase 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuS2 PE=3 SV=1 28 918 1.0E-116
sp|Q970Z6|SYL2_SULTO Leucine--tRNA ligase 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuS2 PE=3 SV=2 33 934 1.0E-116
sp|Q8ZXT6|SYL_PYRAE Leucine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuS PE=3 SV=1 27 963 1.0E-116
sp|Q12WA2|SYL_METBU Leucine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=leuS PE=3 SV=1 36 957 2.0E-116
sp|Q8TQD3|SYL_METAC Leucine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=leuS PE=3 SV=1 36 1078 2.0E-115
sp|A4WHK6|SYL_PYRAR Leucine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=leuS PE=3 SV=1 33 962 1.0E-114
sp|Q58050|SYL_METJA Leucine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuS PE=3 SV=2 36 992 1.0E-114
sp|Q8Q054|SYL_METMA Leucine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=leuS PE=3 SV=2 36 1078 3.0E-114
sp|B1YAS9|SYL_PYRNV Leucine--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=leuS PE=3 SV=1 33 963 6.0E-113
sp|A8A8T2|SYL_IGNH4 Leucine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=leuS PE=3 SV=1 65 986 1.0E-111
sp|Q4J8J7|SYL2_SULAC Leucine--tRNA ligase 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuS2 PE=3 SV=2 34 959 2.0E-111
sp|A1RTX9|SYL_PYRIL Leucine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=leuS PE=3 SV=1 33 963 5.0E-111
sp|Q46AW0|SYL_METBF Leucine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=leuS PE=3 SV=1 36 1000 1.0E-110
sp|A3MU00|SYL_PYRCJ Leucine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=leuS PE=3 SV=1 33 976 2.0E-108
sp|Q974N4|SYL1_SULTO Leucine--tRNA ligase 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuS1 PE=3 SV=1 39 990 3.0E-104
sp|O33768|SYL2_SULSO Leucine--tRNA ligase 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuS2 PE=3 SV=2 36 959 2.0E-103
sp|A4YE96|SYL1_METS5 Leucine--tRNA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuS1 PE=3 SV=1 36 1091 2.0E-100
sp|Q4JBP0|SYL1_SULAC Leucine--tRNA ligase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuS1 PE=3 SV=1 31 962 1.0E-86
sp|P58176|SYL1_SULSO Leucine--tRNA ligase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuS1 PE=3 SV=1 31 970 7.0E-86
sp|Q9HK31|SYL_THEAC Leucine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=leuS PE=3 SV=1 34 918 2.0E-84
sp|C4V8L1|SYLC_NOSCE Probable leucine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100842 PE=3 SV=1 547 873 1.0E-76
sp|Q8SRS8|SYLC_ENCCU Probable leucine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0280 PE=3 SV=1 523 1045 1.0E-75
sp|P61760|SYL_NANEQ Leucine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=leuS PE=3 SV=1 391 912 4.0E-74
sp|Q97AN8|SYL_THEVO Leucine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=leuS PE=3 SV=1 26 812 2.0E-72
sp|B7XHP6|SYLC_ENTBH Probable leucine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21702 PE=3 SV=1 547 996 7.0E-66
sp|C4V8L1|SYLC_NOSCE Probable leucine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100842 PE=3 SV=1 74 449 8.0E-47
sp|Q8SRS8|SYLC_ENCCU Probable leucine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0280 PE=3 SV=1 56 348 5.0E-46
sp|B7XHP6|SYLC_ENTBH Probable leucine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21702 PE=3 SV=1 68 296 4.0E-42
sp|P61760|SYL_NANEQ Leucine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=leuS PE=3 SV=1 76 365 2.0E-18
sp|A3DEU0|SYL_CLOTH Leucine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuS PE=3 SV=1 704 934 5.0E-11
sp|B8CXR8|SYL_HALOH Leucine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuS PE=3 SV=1 749 934 7.0E-11
sp|Q9HMG9|SYV_HALSA Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=valS PE=3 SV=1 707 947 1.0E-10
sp|B0R841|SYV_HALS3 Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=valS PE=3 SV=1 707 947 1.0E-10
sp|Q9HM29|SYV_THEAC Valine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=valS PE=3 SV=1 486 946 1.0E-10
sp|A6TQK3|SYL_ALKMQ Leucine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=leuS PE=3 SV=1 751 935 3.0E-10
sp|Q24SP5|SYL_DESHY Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=leuS PE=3 SV=1 749 984 4.0E-10
sp|B8FUR3|SYL_DESHD Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=leuS PE=3 SV=1 749 984 4.0E-10
sp|Q972A3|SYV_SULTO Valine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=valS PE=3 SV=2 704 959 7.0E-10
sp|Q97ZK9|SYV_SULSO Valine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=valS PE=3 SV=1 707 959 1.0E-09
sp|Q045L5|SYL_LACGA Leucine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=leuS PE=3 SV=1 710 974 4.0E-09
sp|Q3AF30|SYL_CARHZ Leucine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=leuS PE=3 SV=1 749 985 6.0E-09
sp|Q891R5|SYV_CLOTE Valine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=valS PE=3 SV=1 706 990 7.0E-09
sp|Q74KS1|SYL_LACJO Leucine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=leuS PE=3 SV=1 710 974 2.0E-08
sp|Q4J8X1|SYV_SULAC Valine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=valS PE=3 SV=1 704 959 2.0E-08
sp|Q88UX7|SYV_LACPL Valine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=valS PE=3 SV=1 706 934 2.0E-08
sp|Q114V5|SYL_TRIEI Leucine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=leuS PE=3 SV=1 34 127 3.0E-08
sp|A8MJY6|SYL_ALKOO Leucine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=leuS PE=3 SV=1 704 943 4.0E-08
sp|Q182K8|SYL_PEPD6 Leucine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=leuS PE=3 SV=1 745 935 4.0E-08
sp|A8YWU4|SYL_LACH4 Leucine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=leuS PE=3 SV=1 710 934 5.0E-08
sp|Q3IUE5|SYV_NATPD Valine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=valS PE=3 SV=1 517 980 5.0E-08
sp|Q9X2D7|SYV_THEMA Valine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=valS PE=3 SV=1 325 974 8.0E-08
sp|B8HM05|SYL_CYAP4 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=leuS PE=3 SV=1 28 134 9.0E-08
sp|A7HN82|SYL_FERNB Leucine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=leuS PE=3 SV=1 706 935 1.0E-07
sp|Q88XA9|SYL_LACPL Leucine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=leuS PE=3 SV=1 697 934 1.0E-07
sp|A4XKG9|SYL_CALS8 Leucine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=leuS PE=3 SV=1 708 935 2.0E-07
sp|Q8U409|SYV_PYRFU Valine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=valS PE=3 SV=1 701 992 2.0E-07
sp|Q049B7|SYL_LACDB Leucine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=leuS PE=3 SV=1 712 938 3.0E-07
sp|Q1G971|SYL_LACDA Leucine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=leuS PE=3 SV=1 712 938 3.0E-07
sp|Q5FIP3|SYL_LACAC Leucine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=leuS PE=3 SV=1 710 933 6.0E-07
sp|B2A6C2|SYL_NATTJ Leucine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=leuS PE=3 SV=1 704 934 6.0E-07
sp|A0AJB5|SYL_LISW6 Leucine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=leuS PE=3 SV=1 710 934 6.0E-07
sp|Q8RCT6|SYL_CALS4 Leucine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuS PE=3 SV=1 756 935 6.0E-07
sp|Q050D6|SYC_LEPBL Cysteine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=cysS PE=3 SV=1 713 840 6.0E-07
sp|Q04SB0|SYC_LEPBJ Cysteine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=cysS PE=3 SV=1 713 840 6.0E-07
sp|A5G677|SYL_GEOUR Leucine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=leuS PE=3 SV=1 751 956 8.0E-07
sp|A7GU19|SYL_BACCN Leucine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=leuS PE=3 SV=1 710 934 8.0E-07
sp|Q03GG4|SYL_PEDPA Leucine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=leuS PE=3 SV=1 710 934 8.0E-07
sp|B1HXY7|SYL_LYSSC Leucine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=leuS PE=3 SV=1 36 127 9.0E-07
sp|B8DFR1|SYL_LISMH Leucine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=leuS PE=3 SV=1 710 934 9.0E-07
sp|Q71Z07|SYL_LISMF Leucine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuS PE=3 SV=1 710 934 1.0E-06
sp|C1KVV9|SYL_LISMC Leucine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=leuS PE=3 SV=1 710 934 1.0E-06
sp|Q8RBN5|SYV_CALS4 Valine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=valS PE=3 SV=1 323 935 1.0E-06
sp|Q8Y6M4|SYL_LISMO Leucine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuS PE=3 SV=1 710 934 1.0E-06
sp|Q8DH61|SYL_THEEB Leucine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuS PE=3 SV=1 36 127 1.0E-06
sp|A0M5I5|SYV_GRAFK Valine--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=valS PE=3 SV=1 700 976 1.0E-06
sp|Q92AZ9|SYL_LISIN Leucine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuS PE=3 SV=1 710 934 1.0E-06
sp|Q8P7J1|SYL_XANCP Leucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=leuS PE=3 SV=2 634 942 1.0E-06
sp|Q8EP12|SYL_OCEIH Leucine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuS PE=3 SV=1 705 934 2.0E-06
sp|C3PLG3|SYV_RICAE Valine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=valS PE=3 SV=1 37 149 2.0E-06
sp|Q49YI8|SYL_STAS1 Leucine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=leuS PE=3 SV=1 706 948 2.0E-06
sp|Q4UWK8|SYL_XANC8 Leucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=leuS PE=3 SV=2 634 938 2.0E-06
sp|C4K2L1|SYV_RICPU Valine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=valS PE=3 SV=1 37 149 2.0E-06
sp|B0S101|SYL_FINM2 Leucine--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=leuS PE=3 SV=1 704 935 3.0E-06
sp|A8F8B7|SYL_PSELT Leucine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=leuS PE=3 SV=1 697 980 3.0E-06
sp|B0RR06|SYL_XANCB Leucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=leuS PE=3 SV=2 634 938 3.0E-06
sp|C6E100|SYL_GEOSM Leucine--tRNA ligase OS=Geobacter sp. (strain M21) GN=leuS PE=3 SV=1 751 991 4.0E-06
sp|A1WYZ7|SYL_HALHL Leucine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=leuS PE=3 SV=1 750 935 5.0E-06
sp|P23920|SYM_GEOSE Methionine--tRNA ligase OS=Geobacillus stearothermophilus GN=metG PE=3 SV=1 706 977 5.0E-06
sp|B1YKH4|SYL_EXIS2 Leucine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=leuS PE=3 SV=1 706 966 5.0E-06
sp|Q8RDD1|SYM_CALS4 Methionine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=metG PE=3 SV=1 706 807 6.0E-06
sp|B0TBJ3|SYL_HELMI Leucine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuS PE=3 SV=1 749 934 6.0E-06
sp|Q3ZWQ1|SYL_DEHMC Leucine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=leuS PE=3 SV=1 37 134 7.0E-06
sp|A7Z7V7|SYL_BACMF Leucine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=leuS PE=3 SV=1 710 931 7.0E-06
sp|A5FP73|SYL_DEHMB Leucine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=leuS PE=3 SV=1 37 134 7.0E-06
sp|B8GV13|SYL_THISH Leucine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=leuS PE=3 SV=1 750 930 8.0E-06
sp|Q1D8K2|SYM_MYXXD Methionine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=metG PE=3 SV=1 719 921 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0000166 nucleotide binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0005488 binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0006399 tRNA metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0043039 tRNA aminoacylation No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0043038 amino acid activation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9956
MTSTASVPKAMEALSISQPKTKELKGTEKRDSLIAIEKKYQQKWAADRVFEQNAPSIQEVPLHSISAAELREKQP
KFFGCMAYPYMNGVLHAGHTFSASKVEFATGVARMQGKRALFPMGFHCTGMPIKACSDKLVNEIKLFGQDFSGYD
AEQDQAAEEKPAPAAKQTKEDVSKFTTNKSKANAKTVKMKYQFQIMKSIGIPQDEIHRFADPQHWLKFFPPLAIR
DLSDLGCRIDWRRSFVTTDANPYYDAFVRWQMNRLKELNKIKFGKRYTIYSIKDGQPCMDHDRAEGEAVNPQEYT
AMKLKVLEWAPKAAEAIQGKLPEGSDVFLVPATLRPETMYGQTCCFVGPKIKYGVFKAGERAFYVVTERAARNMA
YQGILAQEGVVEKAGEILGADMVGSLVHAPLSCHKSGVRVLPMETVLPTKGTGVVTSVPSDSPDDYATLAELTKK
ADYYGIRKEWAELEILPVIKTPSYGDLCAPFLVKKLKIASPKDTKQLEEAKELAYKEGYYQGVMVVGDFKGEKVE
TAKAKVRSQLMDAGDAFAYSEPERKVVSRSGDDCIVALMDQWYLDYGEESWKRTALAWVDNADGKGLETWTSETK
NSFEGVLNWLNQWACARTYGLGSKLPWDRQFLVESLSDSTIYMAYYTVCHYLHKDLFGRERGVGNVGPEQMVDEV
WDYIFCRRELSDAVLGASKVPRETLESMRREFEYFYPLDVRSSGKDLIPNHLTFFLYVHLAIFPPEYWPRGVRAN
GHLMLNGEKMSKSTGNFMTLHDLVGKYGADAARIALADAGDGVSDANFEEDVADNNILRLFNLREWCEEMMGAEQ
QELRTGPTNSFQDALLDNELNGFAREAMDQYRQTNYKLALKAGLYELMGARDFYREACAAGGIKMHRELVRRYIE
LQCLLLAPVAPHWSEHVWLEVLGKGRTIHEARFPEVAAVDAALSAKREYVRTTSSNVHSAEALQLKKKAKGKEVS
FDPKRAKKLTIYMTDKWPSWQAKYIELLRETWRAGSRSAEEDKALNGRIAKMGEMKKAMPFVQGLKKRLQSGEPA
SVVLEQKLAFDERETLGQMVPGLCRTAGLVACQVVMVEEGGKKGTDVATGQEVAIGASLAAENAVPGLPTFFLEN
VEG*
Coding >Hirsu2|9956
ATGACTTCGACCGCCTCCGTCCCCAAGGCCATGGAGGCCCTCAGCATTTCCCAGCCCAAGACCAAAGAGCTCAAA
GGAACGGAGAAACGAGACTCCCTGATCGCCATCGAAAAGAAGTATCAGCAAAAGTGGGCGGCTGATCGCGTCTTT
GAGCAAAATGCCCCTTCGATCCAGGAGGTGCCCCTGCACTCCATCTCCGCCGCCGAGCTGCGGGAGAAGCAGCCC
AAGTTCTTCGGCTGCATGGCCTACCCCTACATGAACGGCGTCCTGCACGCCGGTCACACCTTTTCCGCCAGCAAG
GTCGAGTTCGCCACCGGCGTGGCCAGGATGCAGGGCAAGCGGGCCTTGTTCCCCATGGGCTTCCACTGCACCGGC
ATGCCCATCAAGGCGTGCTCGGACAAGCTGGTCAACGAGATCAAGCTGTTCGGCCAGGACTTCTCCGGCTACGAT
GCCGAGCAGGACCAGGCCGCCGAGGAGAAGCCCGCGCCGGCCGCCAAGCAGACCAAGGAGGACGTCTCCAAGTTC
ACGACCAACAAGAGCAAGGCCAACGCCAAGACCGTCAAGATGAAGTACCAGTTCCAGATCATGAAGTCGATTGGA
ATCCCCCAAGACGAGATCCACCGATTCGCCGACCCGCAGCATTGGCTCAAGTTCTTCCCCCCGCTGGCCATCCGC
GACCTGTCCGACCTGGGCTGCAGAATCGACTGGCGCCGGTCCTTCGTCACCACCGACGCGAACCCCTACTACGAC
GCCTTCGTCCGGTGGCAGATGAACCGCCTGAAGGAGCTCAACAAGATCAAGTTCGGCAAGCGGTACACAATCTAC
TCCATCAAGGACGGCCAGCCTTGCATGGACCACGACCGCGCCGAGGGCGAGGCGGTCAACCCCCAGGAGTACACG
GCCATGAAGCTCAAGGTCTTGGAGTGGGCCCCCAAGGCCGCCGAGGCCATCCAGGGCAAGCTCCCAGAGGGCTCC
GACGTCTTCCTCGTGCCCGCGACGCTGAGACCGGAGACGATGTACGGACAGACGTGCTGCTTCGTGGGCCCCAAG
ATCAAGTACGGCGTCTTCAAGGCGGGCGAGAGGGCCTTCTACGTCGTCACCGAGAGGGCCGCCCGTAACATGGCC
TACCAGGGGATCCTGGCCCAGGAGGGCGTCGTCGAGAAGGCCGGCGAGATCCTGGGCGCCGACATGGTGGGCAGC
CTGGTCCACGCCCCGCTCTCGTGCCACAAGAGCGGCGTCCGCGTCCTGCCCATGGAGACGGTCCTGCCGACCAAG
GGCACCGGCGTCGTCACGTCGGTGCCCTCGGACAGCCCCGACGACTACGCCACCCTGGCCGAGCTGACCAAGAAG
GCCGACTACTACGGCATCCGGAAGGAGTGGGCCGAGCTCGAAATCTTGCCCGTCATCAAGACGCCCTCGTACGGC
GACCTGTGCGCGCCGTTCCTGGTGAAGAAGCTCAAGATCGCGTCGCCCAAGGACACGAAGCAGCTGGAGGAGGCC
AAGGAGCTGGCGTACAAGGAGGGCTACTACCAGGGTGTCATGGTGGTCGGCGACTTCAAGGGCGAAAAGGTGGAG
ACGGCCAAGGCCAAGGTCAGGAGCCAGCTGATGGACGCCGGCGACGCCTTCGCCTACTCGGAGCCGGAGCGCAAG
GTGGTCAGCCGGTCGGGCGACGACTGCATCGTGGCCCTGATGGACCAGTGGTACCTGGACTACGGCGAGGAGTCG
TGGAAGCGGACGGCGCTGGCATGGGTCGACAACGCCGACGGCAAGGGCCTGGAGACGTGGACGTCGGAGACGAAG
AACAGCTTCGAGGGCGTGCTCAACTGGCTGAACCAGTGGGCGTGCGCGAGGACGTACGGCCTGGGCTCGAAGCTG
CCGTGGGACCGGCAGTTCCTGGTGGAGAGCCTGAGCGACTCGACCATCTACATGGCCTACTACACCGTCTGCCAC
TACCTCCACAAGGACCTGTTCGGCCGCGAGAGGGGCGTCGGCAACGTCGGGCCGGAGCAGATGGTGGACGAGGTC
TGGGACTACATCTTCTGCCGGCGCGAGCTGAGCGACGCGGTGCTGGGCGCGTCCAAGGTGCCGCGGGAGACGCTC
GAGAGCATGCGGCGCGAGTTTGAGTACTTTTACCCGCTGGACGTGCGGAGCTCGGGCAAGGACCTGATCCCGAAC
CACCTGACCTTCTTCCTCTACGTGCACCTGGCCATCTTCCCGCCCGAGTACTGGCCGCGGGGCGTGCGGGCCAAC
GGGCACCTGATGCTCAACGGCGAGAAGATGAGCAAGAGCACGGGCAACTTCATGACGCTGCACGACCTGGTGGGC
AAGTACGGGGCGGACGCGGCGCGGATCGCGCTGGCGGACGCGGGCGACGGCGTCAGCGACGCCAACTTCGAGGAG
GACGTGGCCGACAACAACATCCTGCGACTCTTCAACCTGCGGGAGTGGTGCGAGGAGATGATGGGGGCGGAGCAG
CAGGAGCTGCGGACCGGGCCGACCAACTCGTTCCAGGACGCGCTGCTGGACAACGAGCTCAACGGGTTCGCGCGC
GAGGCCATGGACCAGTACCGGCAGACGAACTACAAGCTGGCGCTCAAGGCGGGCCTCTACGAGCTGATGGGGGCG
CGCGACTTCTACCGCGAGGCGTGCGCGGCGGGCGGCATCAAGATGCACCGGGAGCTGGTGCGGCGGTACATTGAG
CTGCAGTGCCTGCTGCTGGCGCCGGTGGCGCCGCACTGGTCGGAGCACGTCTGGCTCGAGGTGCTGGGCAAGGGC
AGGACGATCCACGAGGCGCGGTTCCCGGAGGTGGCGGCGGTGGACGCGGCGCTGTCGGCCAAGCGCGAGTACGTG
CGGACGACGTCGTCCAACGTGCACTCGGCCGAGGCGCTGCAGCTGAAGAAGAAGGCCAAGGGCAAGGAGGTGTCG
TTCGACCCGAAGCGGGCGAAGAAGCTGACGATCTACATGACGGACAAGTGGCCGTCGTGGCAGGCCAAGTACATT
GAGCTGCTGCGGGAGACGTGGCGGGCGGGGAGCCGGTCGGCGGAGGAGGACAAGGCGCTCAACGGGCGGATCGCC
AAGATGGGGGAGATGAAGAAGGCGATGCCGTTCGTGCAGGGCCTCAAGAAGCGGCTGCAGTCGGGGGAGCCGGCG
AGCGTGGTGCTGGAGCAGAAGCTGGCGTTTGACGAGAGGGAGACGCTGGGGCAGATGGTGCCGGGGCTGTGCCGG
ACGGCCGGGCTGGTGGCATGCCAGGTGGTGATGGTGGAGGAGGGGGGCAAGAAGGGGACGGACGTGGCGACGGGC
CAGGAGGTGGCGATTGGGGCGTCTCTGGCGGCGGAGAACGCCGTGCCCGGGCTGCCGACCTTTTTCCTGGAGAAT
GTCGAGGGCTGA
Transcript >Hirsu2|9956
ATGACTTCGACCGCCTCCGTCCCCAAGGCCATGGAGGCCCTCAGCATTTCCCAGCCCAAGACCAAAGAGCTCAAA
GGAACGGAGAAACGAGACTCCCTGATCGCCATCGAAAAGAAGTATCAGCAAAAGTGGGCGGCTGATCGCGTCTTT
GAGCAAAATGCCCCTTCGATCCAGGAGGTGCCCCTGCACTCCATCTCCGCCGCCGAGCTGCGGGAGAAGCAGCCC
AAGTTCTTCGGCTGCATGGCCTACCCCTACATGAACGGCGTCCTGCACGCCGGTCACACCTTTTCCGCCAGCAAG
GTCGAGTTCGCCACCGGCGTGGCCAGGATGCAGGGCAAGCGGGCCTTGTTCCCCATGGGCTTCCACTGCACCGGC
ATGCCCATCAAGGCGTGCTCGGACAAGCTGGTCAACGAGATCAAGCTGTTCGGCCAGGACTTCTCCGGCTACGAT
GCCGAGCAGGACCAGGCCGCCGAGGAGAAGCCCGCGCCGGCCGCCAAGCAGACCAAGGAGGACGTCTCCAAGTTC
ACGACCAACAAGAGCAAGGCCAACGCCAAGACCGTCAAGATGAAGTACCAGTTCCAGATCATGAAGTCGATTGGA
ATCCCCCAAGACGAGATCCACCGATTCGCCGACCCGCAGCATTGGCTCAAGTTCTTCCCCCCGCTGGCCATCCGC
GACCTGTCCGACCTGGGCTGCAGAATCGACTGGCGCCGGTCCTTCGTCACCACCGACGCGAACCCCTACTACGAC
GCCTTCGTCCGGTGGCAGATGAACCGCCTGAAGGAGCTCAACAAGATCAAGTTCGGCAAGCGGTACACAATCTAC
TCCATCAAGGACGGCCAGCCTTGCATGGACCACGACCGCGCCGAGGGCGAGGCGGTCAACCCCCAGGAGTACACG
GCCATGAAGCTCAAGGTCTTGGAGTGGGCCCCCAAGGCCGCCGAGGCCATCCAGGGCAAGCTCCCAGAGGGCTCC
GACGTCTTCCTCGTGCCCGCGACGCTGAGACCGGAGACGATGTACGGACAGACGTGCTGCTTCGTGGGCCCCAAG
ATCAAGTACGGCGTCTTCAAGGCGGGCGAGAGGGCCTTCTACGTCGTCACCGAGAGGGCCGCCCGTAACATGGCC
TACCAGGGGATCCTGGCCCAGGAGGGCGTCGTCGAGAAGGCCGGCGAGATCCTGGGCGCCGACATGGTGGGCAGC
CTGGTCCACGCCCCGCTCTCGTGCCACAAGAGCGGCGTCCGCGTCCTGCCCATGGAGACGGTCCTGCCGACCAAG
GGCACCGGCGTCGTCACGTCGGTGCCCTCGGACAGCCCCGACGACTACGCCACCCTGGCCGAGCTGACCAAGAAG
GCCGACTACTACGGCATCCGGAAGGAGTGGGCCGAGCTCGAAATCTTGCCCGTCATCAAGACGCCCTCGTACGGC
GACCTGTGCGCGCCGTTCCTGGTGAAGAAGCTCAAGATCGCGTCGCCCAAGGACACGAAGCAGCTGGAGGAGGCC
AAGGAGCTGGCGTACAAGGAGGGCTACTACCAGGGTGTCATGGTGGTCGGCGACTTCAAGGGCGAAAAGGTGGAG
ACGGCCAAGGCCAAGGTCAGGAGCCAGCTGATGGACGCCGGCGACGCCTTCGCCTACTCGGAGCCGGAGCGCAAG
GTGGTCAGCCGGTCGGGCGACGACTGCATCGTGGCCCTGATGGACCAGTGGTACCTGGACTACGGCGAGGAGTCG
TGGAAGCGGACGGCGCTGGCATGGGTCGACAACGCCGACGGCAAGGGCCTGGAGACGTGGACGTCGGAGACGAAG
AACAGCTTCGAGGGCGTGCTCAACTGGCTGAACCAGTGGGCGTGCGCGAGGACGTACGGCCTGGGCTCGAAGCTG
CCGTGGGACCGGCAGTTCCTGGTGGAGAGCCTGAGCGACTCGACCATCTACATGGCCTACTACACCGTCTGCCAC
TACCTCCACAAGGACCTGTTCGGCCGCGAGAGGGGCGTCGGCAACGTCGGGCCGGAGCAGATGGTGGACGAGGTC
TGGGACTACATCTTCTGCCGGCGCGAGCTGAGCGACGCGGTGCTGGGCGCGTCCAAGGTGCCGCGGGAGACGCTC
GAGAGCATGCGGCGCGAGTTTGAGTACTTTTACCCGCTGGACGTGCGGAGCTCGGGCAAGGACCTGATCCCGAAC
CACCTGACCTTCTTCCTCTACGTGCACCTGGCCATCTTCCCGCCCGAGTACTGGCCGCGGGGCGTGCGGGCCAAC
GGGCACCTGATGCTCAACGGCGAGAAGATGAGCAAGAGCACGGGCAACTTCATGACGCTGCACGACCTGGTGGGC
AAGTACGGGGCGGACGCGGCGCGGATCGCGCTGGCGGACGCGGGCGACGGCGTCAGCGACGCCAACTTCGAGGAG
GACGTGGCCGACAACAACATCCTGCGACTCTTCAACCTGCGGGAGTGGTGCGAGGAGATGATGGGGGCGGAGCAG
CAGGAGCTGCGGACCGGGCCGACCAACTCGTTCCAGGACGCGCTGCTGGACAACGAGCTCAACGGGTTCGCGCGC
GAGGCCATGGACCAGTACCGGCAGACGAACTACAAGCTGGCGCTCAAGGCGGGCCTCTACGAGCTGATGGGGGCG
CGCGACTTCTACCGCGAGGCGTGCGCGGCGGGCGGCATCAAGATGCACCGGGAGCTGGTGCGGCGGTACATTGAG
CTGCAGTGCCTGCTGCTGGCGCCGGTGGCGCCGCACTGGTCGGAGCACGTCTGGCTCGAGGTGCTGGGCAAGGGC
AGGACGATCCACGAGGCGCGGTTCCCGGAGGTGGCGGCGGTGGACGCGGCGCTGTCGGCCAAGCGCGAGTACGTG
CGGACGACGTCGTCCAACGTGCACTCGGCCGAGGCGCTGCAGCTGAAGAAGAAGGCCAAGGGCAAGGAGGTGTCG
TTCGACCCGAAGCGGGCGAAGAAGCTGACGATCTACATGACGGACAAGTGGCCGTCGTGGCAGGCCAAGTACATT
GAGCTGCTGCGGGAGACGTGGCGGGCGGGGAGCCGGTCGGCGGAGGAGGACAAGGCGCTCAACGGGCGGATCGCC
AAGATGGGGGAGATGAAGAAGGCGATGCCGTTCGTGCAGGGCCTCAAGAAGCGGCTGCAGTCGGGGGAGCCGGCG
AGCGTGGTGCTGGAGCAGAAGCTGGCGTTTGACGAGAGGGAGACGCTGGGGCAGATGGTGCCGGGGCTGTGCCGG
ACGGCCGGGCTGGTGGCATGCCAGGTGGTGATGGTGGAGGAGGGGGGCAAGAAGGGGACGGACGTGGCGACGGGC
CAGGAGGTGGCGATTGGGGCGTCTCTGGCGGCGGAGAACGCCGTGCCCGGGCTGCCGACCTTTTTCCTGGAGAAT
GTCGAGGGCTGA
Gene >Hirsu2|9956
ATGACTTCGACCGCCTCCGTCCCCAAGGCCATGGAGGCCCTCAGCATTTCCCAGCCCAAGACCAAAGAGCTCAAA
GGAGTGCGCAATCGCCCTCCCCAGCCTTTCGAAATCACCATGCTAGTTCCCCTGCTGACTCTCGTTTCCTTTGCA
TAGACGGAGAAACGAGACTCCCTGATCGCCATCGAAAAGAAGTATCAGCAAAAGTGGGCGGCTGATCGCGTCTTT
GAGCAAAATGCCCCTTCGATCCAGGAGGTGCCCCTGCACTCCATCTCCGCCGCCGAGCTGCGGGAGAAGCAGCCC
AAGTTCTTCGGCTGCATGGCCTACCCCTACATGAACGGCGTCCTGCACGCCGGTCACACCTTTTCCGCCAGCAAG
GTCGAGTTCGCCACCGGCGTGGCCAGGATGCAGGGCAAGCGGGCCTTGTTCCCCATGGGCTTCCACTGCACCGGC
ATGCCCATCAAGGCGTGCTCGGACAAGCTGGTCAACGAGATCAAGCTGTTCGGCCAGGACTTCTCCGGCTACGAT
GCCGAGCAGGACCAGGCCGCCGAGGAGAAGCCCGCGCCGGCCGCCAAGCAGACCAAGGAGGACGTCTCCAAGTTC
ACGACCAACAAGAGCAAGGCCAACGCCAAGACCGTCAAGATGAAGTACCAGTTCCAGATCATGAAGTCGATTGGA
ATCCCCCAAGACGAGATCCACCGATTCGCCGACCCGCAGCATTGGCTCAAGTTCTTCCCCCCGCTGGCCATCCGC
GACCTGTCCGACCTGGGCTGCAGAATCGACTGGCGCCGGTCCTTCGTCACCACCGACGCGAACCCCTACTACGAC
GCCTTCGTCCGGTGGCAGATGAACCGCCTGAAGGAGCTCAACAAGATCAAGTTCGGCAAGCGGTACACAATCTAC
TCCATCAAGGACGGCCAGCCTTGCATGGACCACGACCGCGCCGAGGGCGAGGCGGTCAACCCCCAGGAGTACACG
GCCATGAAGCTCAAGGTCTTGGAGTGGGCCCCCAAGGCCGCCGAGGCCATCCAGGGCAAGCTCCCAGAGGGCTCC
GACGTCTTCCTCGTGCCCGCGACGCTGAGACCGGAGACGATGTACGGACAGACGTGCTGCTTCGTGGGCCCCAAG
ATCAAGTACGGCGTCTTCAAGGCGGGCGAGAGGGCCTTCTACGTCGTCACCGAGAGGGCCGCCCGTAACATGGCC
TACCAGGGGATCCTGGCCCAGGAGGGCGTCGTCGAGAAGGCCGGCGAGATCCTGGGCGCCGACATGGTGGGCAGC
CTGGTCCACGCCCCGCTCTCGTGCCACAAGAGCGGCGTCCGCGTCCTGCCCATGGAGACGGTCCTGCCGACCAAG
GGCACCGGCGTCGTCACGTCGGTGCCCTCGGACAGCCCCGACGACTACGCCACCCTGGCCGAGCTGACCAAGAAG
GCCGACTACTACGGCATCCGGAAGGAGTGGGCCGAGCTCGAAATCTTGCCCGTCATCAAGACGCCCTCGTACGGC
GACCTGTGCGCGCCGTTCCTGGTGAAGAAGCTCAAGATCGCGTCGCCCAAGGACACGAAGCAGCTGGAGGAGGCC
AAGGAGCTGGCGTACAAGGAGGGCTACTACCAGGGTGTCATGGTGGTCGGCGACTTCAAGGGCGAAAAGGTGGAG
ACGGCCAAGGCCAAGGTCAGGAGCCAGCTGATGGACGCCGGCGACGCCTTCGCCTACTCGGAGCCGGAGCGCAAG
GTGGTCAGCCGGTCGGGCGACGACTGCATCGTGGCCCTGATGGACCAGTGGTACCTGGACTACGGCGAGGAGTCG
TGGAAGCGGACGGCGCTGGCATGGGTCGACAACGCCGACGGCAAGGGCCTGGAGACGTGGACGTCGGAGACGAAG
AACAGCTTCGAGGGCGTGCTCAACTGGCTGAACCAGTGGGCGTGCGCGAGGACGTACGGCCTGGGCTCGAAGCTG
CCGTGGGACCGGCAGTTCCTGGTGGAGAGCCTGAGCGACTCGACCATCTACATGGCCTACTACACCGTCTGCCAC
TACCTCCACAAGGACCTGTTCGGCCGCGAGAGGGGCGTCGGCAACGTCGGGCCGGAGCAGATGGTGGACGAGGTC
TGGGACTACATCTTCTGCCGGCGCGAGCTGAGCGACGCGGTGCTGGGCGCGTCCAAGGTGCCGCGGGAGACGCTC
GAGAGCATGCGGCGCGAGTTTGAGTACTTTTACCCGCTGGACGTGCGGAGCTCGGGCAAGGACCTGATCCCGAAC
CACCTGACCTTCTTCCTCTACGTGCACCTGGCCATCTTCCCGCCCGAGTACTGGCCGCGGGGCGTGCGGGCCAAC
GGGCACCTGATGCTCAACGGCGAGAAGATGAGCAAGAGCACGGGCAACTTCATGACGCTGCACGACCTGGTGGGC
AAGTACGGGGCGGACGCGGCGCGGATCGCGCTGGCGGACGCGGGCGACGGCGTCAGCGACGCCAACTTCGAGGAG
GACGTGGCCGACAACAACATCCTGCGACTCTTCAACCTGCGGGAGTGGTGCGAGGAGATGATGGGGGCGGAGCAG
CAGGAGCTGCGGACCGGGCCGACCAACTCGTTCCAGGACGCGCTGCTGGACAACGAGCTCAACGGGTTCGCGCGC
GAGGCCATGGACCAGTACCGGCAGACGAACTACAAGCTGGCGCTCAAGGCGGGCCTCTACGAGCTGATGGGGGCG
CGCGACTTCTACCGCGAGGCGTGCGCGGCGGGCGGCATCAAGATGCACCGGGAGCTGGTGCGGCGGTACATTGAG
CTGCAGTGCCTGCTGCTGGCGCCGGTGGCGCCGCACTGGTCGGAGCACGTCTGGCTCGAGGTGCTGGGCAAGGGC
AGGACGATCCACGAGGCGCGGTTCCCGGAGGTGGCGGCGGTGGACGCGGCGCTGTCGGCCAAGCGCGAGTACGTG
CGGACGACGTCGTCCAACGTGCACTCGGCCGAGGCGCTGCAGCTGAAGAAGAAGGCCAAGGGCAAGGAGGTGTCG
TTCGACCCGAAGCGGGCGAAGAAGCTGACGATCTACATGACGGACAAGTGGCCGTCGTGGCAGGCCAAGTACATT
GAGCTGCTGCGGGAGACGTGGCGGGCGGGGAGCCGGTCGGCGGAGGAGGACAAGGCGCTCAACGGGCGGATCGCC
AAGATGGGGGAGATGAAGAAGGCGATGCCGTTCGTGCAGGGCCTCAAGAAGCGGCTGCAGTCGGGGGAGCCGGCG
AGCGTGGTGCTGGAGCAGAAGCTGGCGTTTGACGAGAGGGAGACGCTGGGGCAGATGGTGCCGGGGCTGTGCCGG
ACGGCCGGGCTGGTGGCATGCCAGGTGGTGATGGTGGAGGAGGGGGGCAAGAAGGGGACGGACGTGGCGACGGGC
CAGGAGGTGGCGATTGGGGCGTCTCTGGCGGCGGAGAACGCCGTGCCCGGGCTGCCGACCTTTTTCCTGGAGAAT
GTCGAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail