Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9951
Gene name
LocationContig_765:479..1348
Strand-
Gene length (bp)869
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04457 MJ1316 MJ1316 RNA cyclic group end recognition domain 1.8E-18 182 251

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96B70|LENG9_HUMAN Leukocyte receptor cluster member 9 OS=Homo sapiens GN=LENG9 PE=2 SV=2 181 262 1.0E-15
sp|Q8BTN6|LENG9_MOUSE Leukocyte receptor cluster member 9 OS=Mus musculus GN=Leng9 PE=2 SV=1 156 262 6.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9951
MLLVDMNRKLPTMGIRIWPARFVQQPSAVHDGGGDGDEGSAEFNASYLIGLDWRGSLAAAATSPGETSDFEQPLQ
AVLGNFETRIHLDNRYYDASCCWMMASIVDAREVGAMRPDSAEWAGDGAGETDSEGEEEERDEDEGADGSQPAGE
EGEGEGAATASSKPAREQRGNQGPRQAGGRFRTAADVINRLRWDRTMDAGDYVVGYRDRFAGVRERALDEWTGEQ
THDDFIPQHRIVHFKRRSDGVVVWERETRLDRVFGSGP*
Coding >Hirsu2|9951
ATGCTACTGGTTGACATGAATCGCAAGTTGCCGACGATGGGCATACGCATCTGGCCGGCTCGGTTCGTGCAGCAA
CCATCTGCAGTGCACGATGGTGGTGGCGACGGCGATGAAGGCAGCGCGGAATTCAATGCGAGTTACTTGATCGGC
CTCGATTGGCGAGGAAGCTTGGCCGCGGCCGCGACGTCGCCGGGCGAGACGAGTGACTTTGAGCAACCGCTCCAG
GCCGTGCTTGGAAACTTCGAGACGCGCATCCATCTGGACAACCGCTACTACGACGCGAGCTGTTGCTGGATGATG
GCGTCGATAGTGGATGCCCGAGAAGTCGGCGCGATGCGGCCGGATTCTGCGGAATGGGCCGGCGACGGGGCTGGG
GAGACGGATTCGGAGGGCGAAGAGGAGGAGCGGGACGAGGACGAAGGTGCTGACGGAAGCCAACCAGCCGGCGAG
GAGGGCGAGGGCGAGGGCGCGGCCACGGCGTCGTCGAAGCCGGCCCGCGAGCAGCGCGGCAACCAAGGCCCGAGG
CAGGCCGGCGGCAGGTTCCGCACGGCGGCCGACGTCATCAACCGGCTGCGCTGGGACCGGACGATGGACGCGGGC
GACTACGTGGTCGGGTACCGGGACCGCTTCGCGGGCGTGCGGGAGCGAGCGCTGGACGAGTGGACGGGCGAGCAG
ACGCACGACGACTTCATCCCGCAGCACCGCATCGTGCACTTCAAGCGCCGCAGCGACGGCGTCGTGGTGTGGGAG
CGCGAGACGAGGCTCGACCGCGTCTTCGGCAGCGGGCCCTGA
Transcript >Hirsu2|9951
ATGCTACTGGTTGACATGAATCGCAAGTTGCCGACGATGGGCATACGCATCTGGCCGGCTCGGTTCGTGCAGCAA
CCATCTGCAGTGCACGATGGTGGTGGCGACGGCGATGAAGGCAGCGCGGAATTCAATGCGAGTTACTTGATCGGC
CTCGATTGGCGAGGAAGCTTGGCCGCGGCCGCGACGTCGCCGGGCGAGACGAGTGACTTTGAGCAACCGCTCCAG
GCCGTGCTTGGAAACTTCGAGACGCGCATCCATCTGGACAACCGCTACTACGACGCGAGCTGTTGCTGGATGATG
GCGTCGATAGTGGATGCCCGAGAAGTCGGCGCGATGCGGCCGGATTCTGCGGAATGGGCCGGCGACGGGGCTGGG
GAGACGGATTCGGAGGGCGAAGAGGAGGAGCGGGACGAGGACGAAGGTGCTGACGGAAGCCAACCAGCCGGCGAG
GAGGGCGAGGGCGAGGGCGCGGCCACGGCGTCGTCGAAGCCGGCCCGCGAGCAGCGCGGCAACCAAGGCCCGAGG
CAGGCCGGCGGCAGGTTCCGCACGGCGGCCGACGTCATCAACCGGCTGCGCTGGGACCGGACGATGGACGCGGGC
GACTACGTGGTCGGGTACCGGGACCGCTTCGCGGGCGTGCGGGAGCGAGCGCTGGACGAGTGGACGGGCGAGCAG
ACGCACGACGACTTCATCCCGCAGCACCGCATCGTGCACTTCAAGCGCCGCAGCGACGGCGTCGTGGTGTGGGAG
CGCGAGACGAGGCTCGACCGCGTCTTCGGCAGCGGGCCCTGA
Gene >Hirsu2|9951
ATGCTACTGGTTGGTAAGTTGACCCAGGGCCGCTCACGGAGATGGCTGTGGCTACGCGCATGATCCCGCAGCAAC
ACTGACATATCGTAGACATGAATCGCAAGTTGCCGACGATGGGCATACGCATCTGGCCGGCTCGGTTCGTGCAGC
AACCATCTGCAGTGCACGATGGTGGTGGCGACGGCGATGAAGGCAGCGCGGAATTCAATGCGAGTTACTTGATCG
GCCTCGATTGGCGAGGAAGCTTGGCCGCGGCCGCGACGTCGCCGGGCGAGACGAGTGACTTTGAGCAACCGCTCC
AGGCCGTGCTTGGAAACTTCGAGACGCGCATCCATCTGGACAACCGCTACTACGACGCGAGCTGTTGCTGGATGA
TGGCGTCGATAGTGGATGCCCGAGAAGTCGGCGCGATGCGGCCGGATTCTGCGGAATGGGCCGGCGACGGGGCTG
GGGAGACGGATTCGGAGGGCGAAGAGGAGGAGCGGGACGAGGACGAAGGTGCTGACGGAAGCCAACCAGCCGGCG
AGGAGGGCGAGGGCGAGGGCGCGGCCACGGCGTCGTCGAAGCCGGCCCGCGAGCAGCGCGGCAACCAAGGCCCGA
GGCAGGCCGGCGGCAGGTTCCGCACGGCGGCCGACGTCATCAACCGGCTGCGCTGGGACCGGACGATGGACGCGG
GCGACTACGTGGTCGGGTACCGGGACCGCTTCGCGGGCGTGCGGGAGCGAGCGCTGGACGAGTGGACGGGCGAGC
AGACGCACGACGACTTCATCCCGCAGCACCGCATCGTGCACTTCAAGCGCCGCAGCGACGGCGTCGTGGTGTGGG
AGCGCGAGACGAGGCTCGACCGCGTCTTCGGCAGCGGGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail