Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9948
Gene name
LocationContig_764:2062..3769
Strand-
Gene length (bp)1707
Transcript length (bp)1707
Coding sequence length (bp)1707
Protein length (aa) 569

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.5E-86 66 518
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-10 50 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 36 545 2.0E-145
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 36 547 5.0E-145
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 36 547 5.0E-145
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 36 547 5.0E-145
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 36 533 4.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 36 545 2.0E-145
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 36 547 5.0E-145
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 36 547 5.0E-145
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 36 547 5.0E-145
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 36 533 4.0E-144
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 29 533 4.0E-144
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 29 533 4.0E-143
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 36 533 5.0E-141
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 59 530 2.0E-33
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 74 544 2.0E-32
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 1 481 8.0E-30
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 64 562 1.0E-27
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 74 555 6.0E-27
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 64 560 2.0E-26
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 5 536 5.0E-26
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 64 560 1.0E-25
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 89 568 1.0E-25
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 64 561 2.0E-25
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 54 544 4.0E-25
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 72 539 2.0E-24
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 74 522 4.0E-24
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 72 526 6.0E-24
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 10 522 6.0E-24
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 72 526 6.0E-24
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 61 562 7.0E-24
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 74 522 1.0E-23
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 1 522 2.0E-23
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 1 522 2.0E-23
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 140 543 3.0E-23
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 74 521 3.0E-23
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 74 522 3.0E-23
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 118 537 3.0E-23
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 59 518 6.0E-23
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 74 522 7.0E-23
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 72 560 7.0E-23
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 55 539 1.0E-22
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 64 567 1.0E-22
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 72 560 2.0E-22
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 118 544 4.0E-22
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 117 515 2.0E-21
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 66 539 3.0E-21
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 64 522 3.0E-21
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 118 529 1.0E-20
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 59 516 2.0E-20
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 118 544 2.0E-20
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 96 529 2.0E-20
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 66 522 2.0E-20
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 65 515 3.0E-20
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 118 545 4.0E-20
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 98 521 7.0E-20
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 96 521 8.0E-20
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 98 521 9.0E-20
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 118 529 1.0E-19
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 118 521 2.0E-19
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 51 539 2.0E-19
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 118 529 2.0E-19
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 97 529 2.0E-19
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 97 529 3.0E-19
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 62 562 6.0E-19
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 118 529 1.0E-18
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 51 539 1.0E-18
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 115 521 1.0E-18
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 118 515 2.0E-18
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 118 536 2.0E-18
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 56 551 3.0E-18
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 96 521 3.0E-18
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 64 522 3.0E-18
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 104 521 3.0E-18
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 136 538 4.0E-18
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 55 520 6.0E-18
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 69 547 9.0E-18
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 118 536 1.0E-17
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 118 536 2.0E-17
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 103 516 2.0E-17
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 157 529 2.0E-17
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 74 560 3.0E-17
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 118 521 3.0E-17
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 74 545 4.0E-17
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 128 526 4.0E-17
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 157 521 5.0E-17
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 102 515 1.0E-16
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 118 536 1.0E-16
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 57 516 1.0E-16
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 94 521 3.0E-16
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 74 514 4.0E-16
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 62 562 4.0E-16
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 42 474 5.0E-16
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 118 522 5.0E-16
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 117 516 6.0E-16
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 74 515 7.0E-16
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 103 515 9.0E-16
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 104 403 2.0E-15
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 28 540 2.0E-15
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 107 521 3.0E-15
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 66 543 3.0E-15
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 117 516 4.0E-15
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 103 515 4.0E-15
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 103 515 6.0E-15
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 80 544 7.0E-15
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 104 403 8.0E-15
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 104 403 1.0E-14
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 119 520 2.0E-14
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 166 553 2.0E-14
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 102 515 3.0E-14
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 180 562 4.0E-14
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 118 523 4.0E-14
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 116 519 4.0E-14
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 116 519 4.0E-14
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 62 562 5.0E-14
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 74 544 5.0E-14
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 116 518 6.0E-14
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 2 520 1.0E-13
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 157 522 1.0E-13
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 104 408 2.0E-13
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 134 522 2.0E-13
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 125 542 2.0E-13
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 130 520 2.0E-13
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 58 507 2.0E-13
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 114 515 3.0E-13
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 112 519 4.0E-13
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 134 522 5.0E-13
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 101 523 6.0E-13
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 132 522 6.0E-13
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 118 515 6.0E-13
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 101 515 1.0E-12
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 112 519 1.0E-12
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 123 521 1.0E-12
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 102 456 2.0E-12
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 74 474 2.0E-12
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 134 522 2.0E-12
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 134 522 2.0E-12
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 156 450 3.0E-12
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 166 548 3.0E-12
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 166 548 3.0E-12
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 57 520 3.0E-12
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 62 515 4.0E-12
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 134 522 5.0E-12
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 66 560 5.0E-12
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 180 539 6.0E-12
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 102 547 7.0E-12
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 104 454 7.0E-12
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 126 515 9.0E-12
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 118 515 1.0E-11
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 116 319 1.0E-11
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 64 515 2.0E-11
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 130 398 2.0E-11
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 163 519 3.0E-11
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 107 464 3.0E-11
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 134 522 4.0E-11
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 102 528 5.0E-11
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 102 528 5.0E-11
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 119 340 6.0E-11
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 74 521 6.0E-11
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 157 533 6.0E-11
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 118 514 7.0E-11
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 157 533 8.0E-11
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 157 536 1.0E-10
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 101 522 1.0E-10
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 134 522 1.0E-10
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 66 514 2.0E-10
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 134 522 3.0E-10
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 157 521 3.0E-10
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 134 522 3.0E-10
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 104 398 3.0E-10
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 118 455 5.0E-10
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 101 522 6.0E-10
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 134 398 8.0E-10
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 101 522 1.0E-09
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 74 398 1.0E-09
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 163 521 1.0E-09
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 72 561 1.0E-09
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 134 348 2.0E-09
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 144 522 2.0E-09
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 157 514 2.0E-09
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 134 522 3.0E-09
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 157 508 3.0E-09
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 130 514 3.0E-09
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 132 385 5.0E-09
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 132 537 6.0E-09
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 100 401 1.0E-08
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 163 521 2.0E-08
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 130 411 3.0E-08
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 72 547 6.0E-08
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 65 508 9.0E-08
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 101 522 1.0E-07
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 49 327 1.0E-07
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 178 454 2.0E-07
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 112 447 2.0E-07
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 102 403 5.0E-07
sp|Q66J52|S226B_XENLA Solute carrier family 22 member 6-B OS=Xenopus laevis GN=slc22a6-b PE=2 SV=1 109 381 5.0E-07
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 74 269 6.0E-07
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 134 522 8.0E-07
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 116 292 1.0E-06
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 156 557 1.0E-06
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 102 515 2.0E-06
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 93 400 4.0E-06
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 71 400 4.0E-06
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 102 515 9.0E-06
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 102 515 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 105 127 22
3 134 156 22
4 160 177 17
5 198 220 22
6 235 257 22
7 320 342 22
8 357 376 19
9 383 405 22
10 420 439 19
11 452 469 17
12 484 501 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9948
MSQATTTEHQQPSGHDGVRRVSAADILKMDESTVCEAAAATEAERNMGLFKSLKLYRKACLWSIFLSTCIVMEGY
DTVILNNLYAYPPFQRKFGVQQPDGSYELTAAWQSGLSNGALVGQVLGLFFNGIIADRIGYRLTLIGALMGCIGF
IFILFFAESLVQLLIGEILIGVPWGVFQTLTTTYAAEVCPTHLRAYLTTYVNLCWVIGQFIASGVLRAMVLRDDQ
WGYKIPFALEWAWPIPLMIGIYLAPESPWWLVRHGRLEDAKKSIIRLTSRNTGVVFDADETLSMMVHTNAMEKEA
VAGTSYKDLFKGANRRRTEIVCVTWMIQTLCGSTFMGYSTYFYQQAGLAVENSFNMSLGQYALGAIGTLTAWFLM
SLAGRRTLYLCGQLTMCSLLLIIGCASFAGRENVAAQWAIGSMLLAYTFTYDATVGPVCYSLVSELTSTRLRTKS
VVLARNVYNIVGIVTNIITPRMLNPTAWNWGAKSGFFWASSCLACAVWTYFRLPEPKGRTYGELDILFENRVSAR
KFKTTPVDRVDAEHVENTPEGEKGSEAVMLERVENRSPGKTTQ*
Coding >Hirsu2|9948
ATGTCTCAGGCAACGACAACGGAGCACCAACAGCCGTCCGGCCACGACGGCGTGCGTCGCGTGTCTGCTGCCGAC
ATTCTCAAGATGGACGAGTCGACCGTCTGTGAAGCCGCCGCCGCCACCGAGGCTGAGCGGAATATGGGCCTCTTC
AAATCGCTGAAGCTGTATAGGAAGGCCTGTCTCTGGTCCATCTTCCTCTCCACATGCATCGTCATGGAGGGCTAC
GACACCGTCATACTCAACAACCTCTACGCCTATCCGCCCTTCCAGCGCAAGTTCGGCGTCCAGCAGCCCGACGGC
TCCTATGAGCTCACGGCCGCCTGGCAGTCTGGCCTATCCAACGGCGCGCTTGTTGGACAAGTCCTTGGCCTCTTC
TTCAACGGCATCATCGCCGACCGCATTGGCTATCGACTGACGCTGATCGGCGCGCTCATGGGCTGCATCGGCTTC
ATCTTCATCCTCTTCTTTGCCGAGTCTCTTGTTCAGCTGCTCATAGGAGAGATCCTCATCGGCGTCCCGTGGGGT
GTCTTCCAAACCCTGACGACCACGTACGCCGCCGAAGTTTGCCCTACCCACCTGCGGGCCTACCTGACGACCTAC
GTCAACCTGTGCTGGGTCATCGGACAGTTCATCGCCTCGGGCGTGCTGCGCGCCATGGTCCTGCGCGACGACCAG
TGGGGATACAAGATCCCCTTTGCGCTCGAGTGGGCGTGGCCTATCCCTCTCATGATCGGCATCTACCTCGCACCG
GAGTCCCCGTGGTGGCTCGTCCGCCACGGCCGGCTCGAGGACGCCAAGAAGTCCATCATTCGCCTGACGTCACGC
AATACCGGCGTCGTCTTCGATGCCGACGAGACGTTATCCATGATGGTTCACACGAACGCCATGGAGAAGGAGGCC
GTCGCCGGCACGTCTTACAAGGACCTGTTCAAGGGTGCCAACCGCCGCCGGACCGAGATCGTCTGCGTGACGTGG
ATGATCCAAACGCTCTGCGGCTCCACCTTCATGGGATACTCGACATACTTCTACCAGCAGGCAGGCCTGGCCGTC
GAGAATTCGTTCAACATGTCTCTGGGCCAGTATGCCCTGGGCGCCATCGGTACGCTGACGGCCTGGTTCCTCATG
AGTCTGGCAGGCCGCCGAACCCTGTACCTCTGCGGCCAGTTGACCATGTGCAGCCTGCTGCTAATCATCGGCTGC
GCATCTTTTGCTGGGCGGGAGAACGTGGCGGCCCAGTGGGCCATCGGCTCTATGCTACTGGCCTACACCTTCACC
TACGACGCCACGGTCGGACCCGTGTGCTACTCTCTCGTATCGGAACTGACGTCGACGCGTCTGCGCACCAAGTCG
GTCGTGCTGGCCCGCAATGTGTACAACATTGTCGGTATCGTGACGAACATCATCACACCTCGCATGCTCAACCCC
ACCGCCTGGAACTGGGGTGCCAAGTCGGGCTTCTTCTGGGCCAGCTCCTGCTTGGCCTGCGCCGTGTGGACCTAC
TTCCGTCTGCCCGAGCCCAAGGGCCGCACATATGGCGAGCTCGACATCCTGTTTGAGAACCGGGTCAGCGCGCGC
AAGTTCAAGACGACGCCCGTTGACAGGGTCGATGCTGAGCACGTCGAAAACACGCCGGAAGGTGAGAAGGGCTCC
GAGGCCGTGATGCTGGAACGCGTCGAAAACCGATCGCCCGGCAAGACGACCCAGTGA
Transcript >Hirsu2|9948
ATGTCTCAGGCAACGACAACGGAGCACCAACAGCCGTCCGGCCACGACGGCGTGCGTCGCGTGTCTGCTGCCGAC
ATTCTCAAGATGGACGAGTCGACCGTCTGTGAAGCCGCCGCCGCCACCGAGGCTGAGCGGAATATGGGCCTCTTC
AAATCGCTGAAGCTGTATAGGAAGGCCTGTCTCTGGTCCATCTTCCTCTCCACATGCATCGTCATGGAGGGCTAC
GACACCGTCATACTCAACAACCTCTACGCCTATCCGCCCTTCCAGCGCAAGTTCGGCGTCCAGCAGCCCGACGGC
TCCTATGAGCTCACGGCCGCCTGGCAGTCTGGCCTATCCAACGGCGCGCTTGTTGGACAAGTCCTTGGCCTCTTC
TTCAACGGCATCATCGCCGACCGCATTGGCTATCGACTGACGCTGATCGGCGCGCTCATGGGCTGCATCGGCTTC
ATCTTCATCCTCTTCTTTGCCGAGTCTCTTGTTCAGCTGCTCATAGGAGAGATCCTCATCGGCGTCCCGTGGGGT
GTCTTCCAAACCCTGACGACCACGTACGCCGCCGAAGTTTGCCCTACCCACCTGCGGGCCTACCTGACGACCTAC
GTCAACCTGTGCTGGGTCATCGGACAGTTCATCGCCTCGGGCGTGCTGCGCGCCATGGTCCTGCGCGACGACCAG
TGGGGATACAAGATCCCCTTTGCGCTCGAGTGGGCGTGGCCTATCCCTCTCATGATCGGCATCTACCTCGCACCG
GAGTCCCCGTGGTGGCTCGTCCGCCACGGCCGGCTCGAGGACGCCAAGAAGTCCATCATTCGCCTGACGTCACGC
AATACCGGCGTCGTCTTCGATGCCGACGAGACGTTATCCATGATGGTTCACACGAACGCCATGGAGAAGGAGGCC
GTCGCCGGCACGTCTTACAAGGACCTGTTCAAGGGTGCCAACCGCCGCCGGACCGAGATCGTCTGCGTGACGTGG
ATGATCCAAACGCTCTGCGGCTCCACCTTCATGGGATACTCGACATACTTCTACCAGCAGGCAGGCCTGGCCGTC
GAGAATTCGTTCAACATGTCTCTGGGCCAGTATGCCCTGGGCGCCATCGGTACGCTGACGGCCTGGTTCCTCATG
AGTCTGGCAGGCCGCCGAACCCTGTACCTCTGCGGCCAGTTGACCATGTGCAGCCTGCTGCTAATCATCGGCTGC
GCATCTTTTGCTGGGCGGGAGAACGTGGCGGCCCAGTGGGCCATCGGCTCTATGCTACTGGCCTACACCTTCACC
TACGACGCCACGGTCGGACCCGTGTGCTACTCTCTCGTATCGGAACTGACGTCGACGCGTCTGCGCACCAAGTCG
GTCGTGCTGGCCCGCAATGTGTACAACATTGTCGGTATCGTGACGAACATCATCACACCTCGCATGCTCAACCCC
ACCGCCTGGAACTGGGGTGCCAAGTCGGGCTTCTTCTGGGCCAGCTCCTGCTTGGCCTGCGCCGTGTGGACCTAC
TTCCGTCTGCCCGAGCCCAAGGGCCGCACATATGGCGAGCTCGACATCCTGTTTGAGAACCGGGTCAGCGCGCGC
AAGTTCAAGACGACGCCCGTTGACAGGGTCGATGCTGAGCACGTCGAAAACACGCCGGAAGGTGAGAAGGGCTCC
GAGGCCGTGATGCTGGAACGCGTCGAAAACCGATCGCCCGGCAAGACGACCCAGTGA
Gene >Hirsu2|9948
ATGTCTCAGGCAACGACAACGGAGCACCAACAGCCGTCCGGCCACGACGGCGTGCGTCGCGTGTCTGCTGCCGAC
ATTCTCAAGATGGACGAGTCGACCGTCTGTGAAGCCGCCGCCGCCACCGAGGCTGAGCGGAATATGGGCCTCTTC
AAATCGCTGAAGCTGTATAGGAAGGCCTGTCTCTGGTCCATCTTCCTCTCCACATGCATCGTCATGGAGGGCTAC
GACACCGTCATACTCAACAACCTCTACGCCTATCCGCCCTTCCAGCGCAAGTTCGGCGTCCAGCAGCCCGACGGC
TCCTATGAGCTCACGGCCGCCTGGCAGTCTGGCCTATCCAACGGCGCGCTTGTTGGACAAGTCCTTGGCCTCTTC
TTCAACGGCATCATCGCCGACCGCATTGGCTATCGACTGACGCTGATCGGCGCGCTCATGGGCTGCATCGGCTTC
ATCTTCATCCTCTTCTTTGCCGAGTCTCTTGTTCAGCTGCTCATAGGAGAGATCCTCATCGGCGTCCCGTGGGGT
GTCTTCCAAACCCTGACGACCACGTACGCCGCCGAAGTTTGCCCTACCCACCTGCGGGCCTACCTGACGACCTAC
GTCAACCTGTGCTGGGTCATCGGACAGTTCATCGCCTCGGGCGTGCTGCGCGCCATGGTCCTGCGCGACGACCAG
TGGGGATACAAGATCCCCTTTGCGCTCGAGTGGGCGTGGCCTATCCCTCTCATGATCGGCATCTACCTCGCACCG
GAGTCCCCGTGGTGGCTCGTCCGCCACGGCCGGCTCGAGGACGCCAAGAAGTCCATCATTCGCCTGACGTCACGC
AATACCGGCGTCGTCTTCGATGCCGACGAGACGTTATCCATGATGGTTCACACGAACGCCATGGAGAAGGAGGCC
GTCGCCGGCACGTCTTACAAGGACCTGTTCAAGGGTGCCAACCGCCGCCGGACCGAGATCGTCTGCGTGACGTGG
ATGATCCAAACGCTCTGCGGCTCCACCTTCATGGGATACTCGACATACTTCTACCAGCAGGCAGGCCTGGCCGTC
GAGAATTCGTTCAACATGTCTCTGGGCCAGTATGCCCTGGGCGCCATCGGTACGCTGACGGCCTGGTTCCTCATG
AGTCTGGCAGGCCGCCGAACCCTGTACCTCTGCGGCCAGTTGACCATGTGCAGCCTGCTGCTAATCATCGGCTGC
GCATCTTTTGCTGGGCGGGAGAACGTGGCGGCCCAGTGGGCCATCGGCTCTATGCTACTGGCCTACACCTTCACC
TACGACGCCACGGTCGGACCCGTGTGCTACTCTCTCGTATCGGAACTGACGTCGACGCGTCTGCGCACCAAGTCG
GTCGTGCTGGCCCGCAATGTGTACAACATTGTCGGTATCGTGACGAACATCATCACACCTCGCATGCTCAACCCC
ACCGCCTGGAACTGGGGTGCCAAGTCGGGCTTCTTCTGGGCCAGCTCCTGCTTGGCCTGCGCCGTGTGGACCTAC
TTCCGTCTGCCCGAGCCCAAGGGCCGCACATATGGCGAGCTCGACATCCTGTTTGAGAACCGGGTCAGCGCGCGC
AAGTTCAAGACGACGCCCGTTGACAGGGTCGATGCTGAGCACGTCGAAAACACGCCGGAAGGTGAGAAGGGCTCC
GAGGCCGTGATGCTGGAACGCGTCGAAAACCGATCGCCCGGCAAGACGACCCAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail