Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9947
Gene name
LocationContig_763:10920..12625
Strand-
Gene length (bp)1705
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00995 Sec1 Sec1 family 2.1E-109 3 521

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q63615|VP33A_RAT Vacuolar protein sorting-associated protein 33A OS=Rattus norvegicus GN=Vps33a PE=1 SV=1 1 521 7.0E-95
sp|Q96AX1|VP33A_HUMAN Vacuolar protein sorting-associated protein 33A OS=Homo sapiens GN=VPS33A PE=1 SV=1 1 521 1.0E-94
sp|Q9D2N9|VP33A_MOUSE Vacuolar protein sorting-associated protein 33A OS=Mus musculus GN=Vps33a PE=1 SV=2 1 521 2.0E-93
sp|Q94KJ7|VPS33_ARATH Vacuolar protein-sorting-associated protein 33 homolog OS=Arabidopsis thaliana GN=VPS33 PE=1 SV=1 4 520 5.0E-87
sp|Q9P7V6|VPS33_SCHPO Vacuolar protein sorting-associated protein 33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps33 PE=3 SV=1 1 522 1.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q63615|VP33A_RAT Vacuolar protein sorting-associated protein 33A OS=Rattus norvegicus GN=Vps33a PE=1 SV=1 1 521 7.0E-95
sp|Q96AX1|VP33A_HUMAN Vacuolar protein sorting-associated protein 33A OS=Homo sapiens GN=VPS33A PE=1 SV=1 1 521 1.0E-94
sp|Q9D2N9|VP33A_MOUSE Vacuolar protein sorting-associated protein 33A OS=Mus musculus GN=Vps33a PE=1 SV=2 1 521 2.0E-93
sp|Q94KJ7|VPS33_ARATH Vacuolar protein-sorting-associated protein 33 homolog OS=Arabidopsis thaliana GN=VPS33 PE=1 SV=1 4 520 5.0E-87
sp|Q9P7V6|VPS33_SCHPO Vacuolar protein sorting-associated protein 33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps33 PE=3 SV=1 1 522 1.0E-75
sp|Q58EN8|VP33B_DANRE Vacuolar protein sorting-associated protein 33B OS=Danio rerio GN=vps33b PE=2 SV=1 4 517 2.0E-67
sp|P59016|VP33B_MOUSE Vacuolar protein sorting-associated protein 33B OS=Mus musculus GN=Vps33b PE=1 SV=1 3 517 1.0E-64
sp|Q63616|VP33B_RAT Vacuolar protein sorting-associated protein 33B OS=Rattus norvegicus GN=Vps33b PE=2 SV=1 3 520 2.0E-64
sp|Q2HJ18|VP33B_BOVIN Vacuolar protein sorting-associated protein 33B OS=Bos taurus GN=VPS33B PE=2 SV=1 3 520 2.0E-64
sp|Q9Y1I2|VP33A_DROME Vacuolar protein sorting-associated protein 33A OS=Drosophila melanogaster GN=car PE=1 SV=1 7 519 4.0E-64
sp|Q9H267|VP33B_HUMAN Vacuolar protein sorting-associated protein 33B OS=Homo sapiens GN=VPS33B PE=1 SV=2 3 517 1.0E-62
sp|P20795|VPS33_YEAST Vacuolar protein sorting-associated protein 33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS33 PE=1 SV=1 65 521 2.0E-31
sp|P34260|VP33A_CAEEL Vacuolar protein sorting-associated protein 33A OS=Caenorhabditis elegans GN=vps-33.1 PE=1 SV=4 17 520 2.0E-26
sp|Q15833|STXB2_HUMAN Syntaxin-binding protein 2 OS=Homo sapiens GN=STXBP2 PE=1 SV=2 17 521 5.0E-19
sp|Q64324|STXB2_MOUSE Syntaxin-binding protein 2 OS=Mus musculus GN=Stxbp2 PE=1 SV=1 17 521 2.0E-18
sp|Q28288|STXB2_CANLF Syntaxin-binding protein 2 OS=Canis lupus familiaris GN=STXBP2 PE=2 SV=1 17 521 7.0E-18
sp|Q62753|STXB2_RAT Syntaxin-binding protein 2 OS=Rattus norvegicus GN=Stxbp2 PE=2 SV=1 17 389 1.0E-16
sp|Q6R748|STXB1_CHICK Syntaxin-binding protein 1 OS=Gallus gallus GN=STXBP1 PE=2 SV=1 17 441 2.0E-16
sp|P61765|STXB1_RAT Syntaxin-binding protein 1 OS=Rattus norvegicus GN=Stxbp1 PE=1 SV=1 17 441 2.0E-15
sp|Q5R6D2|STXB1_PONAB Syntaxin-binding protein 1 OS=Pongo abelii GN=STXBP1 PE=2 SV=1 17 441 2.0E-15
sp|O08599|STXB1_MOUSE Syntaxin-binding protein 1 OS=Mus musculus GN=Stxbp1 PE=1 SV=2 17 441 2.0E-15
sp|P61764|STXB1_HUMAN Syntaxin-binding protein 1 OS=Homo sapiens GN=STXBP1 PE=1 SV=1 17 441 2.0E-15
sp|P61763|STXB1_BOVIN Syntaxin-binding protein 1 OS=Bos taurus GN=STXBP1 PE=1 SV=1 17 441 2.0E-15
sp|Q07327|ROP_DROME Protein ROP OS=Drosophila melanogaster GN=Rop PE=2 SV=2 17 327 1.0E-14
sp|Q09805|VPS45_SCHPO Vacuolar protein sorting-associated protein 45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps45 PE=3 SV=1 117 327 3.0E-13
sp|P34815|UNC18_CAEEL Putative acetylcholine regulator unc-18 OS=Caenorhabditis elegans GN=unc-18 PE=2 SV=3 17 277 5.0E-13
sp|Q54GE3|VPS45_DICDI Vacuolar protein sorting-associated protein 45 OS=Dictyostelium discoideum GN=vps45 PE=1 SV=1 117 307 8.0E-13
sp|O49048|VPS45_ARATH Vacuolar protein sorting-associated protein 45 homolog OS=Arabidopsis thaliana GN=VPS45 PE=1 SV=2 77 307 6.0E-11
sp|Q60770|STXB3_MOUSE Syntaxin-binding protein 3 OS=Mus musculus GN=Stxbp3 PE=1 SV=1 20 281 9.0E-11
sp|O00186|STXB3_HUMAN Syntaxin-binding protein 3 OS=Homo sapiens GN=STXBP3 PE=1 SV=2 20 281 3.0E-10
sp|Q9C5X3|KEULE_ARATH SNARE-interacting protein KEULE OS=Arabidopsis thaliana GN=KEU PE=1 SV=2 110 517 1.0E-09
sp|Q9SZ77|SEC1B_ARATH Protein transport Sec1b OS=Arabidopsis thaliana GN=SEC1B PE=2 SV=3 110 518 2.0E-09
sp|O08700|VPS45_RAT Vacuolar protein sorting-associated protein 45 OS=Rattus norvegicus GN=Vps45 PE=1 SV=1 117 306 2.0E-09
sp|P97390|VPS45_MOUSE Vacuolar protein sorting-associated protein 45 OS=Mus musculus GN=Vps45 PE=1 SV=1 117 306 3.0E-09
sp|Q54QC8|SEC1_DICDI Protein transport protein sec1 OS=Dictyostelium discoideum GN=sec1 PE=3 SV=1 17 368 6.0E-09
sp|Q9C5P7|SEC1A_ARATH Protein transport Sec1a OS=Arabidopsis thaliana GN=SEC1A PE=2 SV=3 110 308 1.0E-08
sp|O94590|SEC1_SCHPO Protein transport protein sec1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec1 PE=3 SV=1 103 277 5.0E-07
sp|Q7XWP3|SEC1A_ORYSJ Probable protein transport Sec1a OS=Oryza sativa subsp. japonica GN=Os04g0252400 PE=3 SV=2 17 309 8.0E-07
sp|Q9NRW7|VPS45_HUMAN Vacuolar protein sorting-associated protein 45 OS=Homo sapiens GN=VPS45 PE=1 SV=1 117 289 1.0E-06
sp|P38932|VPS45_YEAST Vacuolar protein sorting-associated protein 45 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS45 PE=1 SV=2 117 306 1.0E-06
sp|Q5VNU3|SEC1B_ORYSJ Probable protein transport Sec1b OS=Oryza sativa subsp. japonica GN=Os06g0135900 PE=2 SV=1 110 308 3.0E-06
sp|Q62991|SCFD1_RAT Sec1 family domain-containing protein 1 OS=Rattus norvegicus GN=Scfd1 PE=1 SV=1 117 318 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006904 vesicle docking involved in exocytosis Yes
GO:0016192 vesicle-mediated transport Yes
GO:0009987 cellular process No
GO:0140056 organelle localization by membrane tethering No
GO:0008150 biological_process No
GO:0022406 membrane docking No
GO:0048278 vesicle docking No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0140029 exocytic process No
GO:0051640 organelle localization No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 479 501 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9947
LVTDQLLEEAGVLGDVSISELPLFFFPLEKDVLSLELDDSFRDLYLSKDVTPNYLMARALMEVQQNHGLFPRIVG
KGDNAKRVADLLCRLRQELLAGDDATDSGKAGLTPSTTNESVVIIDREVDFVTPLLTQLTYEGLIDELFEIQNNQ
AKVDTTVVGAPTQSSAATSQSRKRTIQLDSSDKLYEQLRDANFAIVGGLLNKIARRLQQVHSDYESKQKTKSLAE
LKEFVGRLPGYQQEHQSARIHTGLAEEIIKHTRTDQFKGLLEVQQNLAAGADPSSQYDCIEELIARDTPLRETLR
LLCIYSCISGGVKPKEYDSFRRLILQGYGYQHILTLANLEKLQLFLSRSSPLAGMIPMTGGAASGSGNKTNYTYL
RKQLRLIVDEVQEDDPNDVSYVYSGYAPLSIRLVQCVLQKQYLLSVTKGSGGGSTAATGVGMQGWHGFDEAVKHV
RGQTFYELQKGEDKAVKARALLSGGGQKQTVFVVFVGGITFTEIAALRFLAKQEESRRNIVICTTSIISGTGASS
*
Coding >Hirsu2|9947
CTGGTTACCGACCAGCTGCTCGAGGAGGCCGGCGTCCTGGGCGATGTCAGCATTTCCGAGCTGCCCTTGTTCTTC
TTTCCGCTCGAGAAAGATGTCTTGTCTCTGGAGCTTGACGATTCCTTTCGGGACCTCTACCTGTCCAAGGACGTC
ACCCCCAACTACCTGATGGCTAGGGCTCTGATGGAAGTGCAGCAGAACCACGGCCTGTTCCCCCGGATAGTCGGA
AAAGGAGACAATGCGAAACGGGTCGCCGACCTGTTGTGTCGCCTGCGACAGGAGCTGCTCGCCGGCGACGACGCC
ACCGACTCCGGCAAGGCCGGCCTCACGCCAAGCACGACCAACGAGAGTGTCGTCATCATCGACCGCGAGGTCGAC
TTCGTCACTCCCCTCCTCACGCAGCTGACGTACGAAGGCCTTATCGACGAGCTGTTTGAGATACAGAACAACCAA
GCCAAAGTCGATACGACCGTCGTCGGGGCGCCCACGCAATCCTCGGCCGCGACATCCCAGAGCAGAAAGCGGACG
ATACAGCTGGATTCGAGCGACAAGCTGTACGAGCAGCTGCGAGATGCCAACTTCGCCATCGTCGGGGGCCTGCTC
AACAAGATTGCCCGCCGGCTGCAGCAGGTGCACAGCGACTACGAGAGCAAACAGAAGACGAAGTCGCTGGCCGAG
CTCAAGGAGTTTGTGGGACGGCTGCCCGGCTACCAGCAAGAGCACCAGAGCGCGAGGATACACACGGGGCTGGCC
GAGGAGATCATCAAACACACGCGCACCGATCAATTCAAAGGCCTCCTCGAGGTGCAGCAGAATCTAGCCGCCGGC
GCGGACCCATCGTCTCAATACGACTGCATCGAGGAGCTCATCGCCCGCGACACGCCGCTGCGGGAAACCCTGCGG
CTGCTGTGCATCTACTCTTGCATATCCGGGGGCGTCAAGCCCAAGGAGTACGATAGTTTTCGGCGCCTGATCCTC
CAAGGCTACGGTTACCAACACATCTTGACGCTGGCCAACCTCGAGAAGCTGCAGCTCTTCCTGTCCCGCTCGTCG
CCGCTAGCCGGTATGATTCCCATGACGGGCGGCGCCGCCAGCGGGAGCGGCAACAAGACCAACTACACGTATCTG
CGGAAGCAGCTCCGTCTGATCGTGGACGAGGTCCAAGAGGACGACCCCAACGACGTGTCGTACGTGTACAGCGGA
TACGCGCCGCTCTCGATCCGACTCGTCCAATGCGTGCTGCAGAAGCAATATCTTCTCTCCGTCACCAAGGGCAGC
GGCGGAGGCAGCACGGCCGCGACCGGGGTGGGGATGCAGGGCTGGCATGGCTTCGACGAGGCCGTCAAACATGTG
CGCGGGCAGACGTTCTACGAGCTCCAGAAGGGCGAAGACAAGGCCGTCAAGGCACGCGCCCTGCTGTCTGGGGGT
GGCCAGAAACAAACAGTCTTCGTCGTCTTCGTGGGCGGCATCACCTTCACCGAGATTGCCGCGCTTCGCTTCCTG
GCCAAGCAAGAGGAGAGCCGCCGGAATATCGTCATTTGCACCACCTCCATCATTAGCGGGACCGGCGCCTCAAGC
TGA
Transcript >Hirsu2|9947
CTGGTTACCGACCAGCTGCTCGAGGAGGCCGGCGTCCTGGGCGATGTCAGCATTTCCGAGCTGCCCTTGTTCTTC
TTTCCGCTCGAGAAAGATGTCTTGTCTCTGGAGCTTGACGATTCCTTTCGGGACCTCTACCTGTCCAAGGACGTC
ACCCCCAACTACCTGATGGCTAGGGCTCTGATGGAAGTGCAGCAGAACCACGGCCTGTTCCCCCGGATAGTCGGA
AAAGGAGACAATGCGAAACGGGTCGCCGACCTGTTGTGTCGCCTGCGACAGGAGCTGCTCGCCGGCGACGACGCC
ACCGACTCCGGCAAGGCCGGCCTCACGCCAAGCACGACCAACGAGAGTGTCGTCATCATCGACCGCGAGGTCGAC
TTCGTCACTCCCCTCCTCACGCAGCTGACGTACGAAGGCCTTATCGACGAGCTGTTTGAGATACAGAACAACCAA
GCCAAAGTCGATACGACCGTCGTCGGGGCGCCCACGCAATCCTCGGCCGCGACATCCCAGAGCAGAAAGCGGACG
ATACAGCTGGATTCGAGCGACAAGCTGTACGAGCAGCTGCGAGATGCCAACTTCGCCATCGTCGGGGGCCTGCTC
AACAAGATTGCCCGCCGGCTGCAGCAGGTGCACAGCGACTACGAGAGCAAACAGAAGACGAAGTCGCTGGCCGAG
CTCAAGGAGTTTGTGGGACGGCTGCCCGGCTACCAGCAAGAGCACCAGAGCGCGAGGATACACACGGGGCTGGCC
GAGGAGATCATCAAACACACGCGCACCGATCAATTCAAAGGCCTCCTCGAGGTGCAGCAGAATCTAGCCGCCGGC
GCGGACCCATCGTCTCAATACGACTGCATCGAGGAGCTCATCGCCCGCGACACGCCGCTGCGGGAAACCCTGCGG
CTGCTGTGCATCTACTCTTGCATATCCGGGGGCGTCAAGCCCAAGGAGTACGATAGTTTTCGGCGCCTGATCCTC
CAAGGCTACGGTTACCAACACATCTTGACGCTGGCCAACCTCGAGAAGCTGCAGCTCTTCCTGTCCCGCTCGTCG
CCGCTAGCCGGTATGATTCCCATGACGGGCGGCGCCGCCAGCGGGAGCGGCAACAAGACCAACTACACGTATCTG
CGGAAGCAGCTCCGTCTGATCGTGGACGAGGTCCAAGAGGACGACCCCAACGACGTGTCGTACGTGTACAGCGGA
TACGCGCCGCTCTCGATCCGACTCGTCCAATGCGTGCTGCAGAAGCAATATCTTCTCTCCGTCACCAAGGGCAGC
GGCGGAGGCAGCACGGCCGCGACCGGGGTGGGGATGCAGGGCTGGCATGGCTTCGACGAGGCCGTCAAACATGTG
CGCGGGCAGACGTTCTACGAGCTCCAGAAGGGCGAAGACAAGGCCGTCAAGGCACGCGCCCTGCTGTCTGGGGGT
GGCCAGAAACAAACAGTCTTCGTCGTCTTCGTGGGCGGCATCACCTTCACCGAGATTGCCGCGCTTCGCTTCCTG
GCCAAGCAAGAGGAGAGCCGCCGGAATATCGTCATTTGCACCACCTCCATCATTAGCGGGACCGGCGCCTCAAGC
TGA
Gene >Hirsu2|9947
CTGGTTACCGACCAGCTGCTCGAGGAGGCCGGCGTCCTGGGCGATGTCAGCATTTCCGAGCTGCCCTTGTTCTTC
TTTCCGCTCGAGAAAGATGTCTTGTCTCTGGAGCTTGACGATTCCTTTCGGGACCTCTACCTGTCCAAGGACGTC
ACCCCCAACTACCTGATGGCTAGGGCTCTGATGGAAGTGCAGCAGAACCACGGCCTGTTCCCCCGGATAGTCGGA
AAAGGAGACAATGCGAAACGGGTCGCCGACCTGTTGTGTCGCCTGCGACAGGAGCTGCTCGCCGGCGACGACGCC
ACCGACTCCGGCAAGGCCGGCCTCACGCCAAGCACGACCAACGAGAGTGTCGTCATCATCGACCGCGAGGTCGAC
TTCGTCACTCCCCTCCTCACGCAGCTGACGTACGAAGGCCTTATCGACGAGCTGTTTGAGATACAGAACAACCAA
GCCAAAGTCGATACGACCGTCGTCGGGGCGCCCACGCAATCCTCGGCCGCGACATCCCAGAGCAGAAAGCGGACG
ATACAGCTGGATTCGAGCGACAAGCTGTACGAGCAGCTGCGAGATGCCAACTTCGCCATCGTCGGGGGCCTGCTC
AACAAGATTGCCCGCCGGCTGCAGCAGGTGCACAGCGACTACGAGAGCAAACAGAAGACGAAGTCGCTGGCCGAG
CTCAAGGAGTTTGTGGGACGGCTGCCCGGCTACCAGCAAGAGCACCAGAGCGCGAGGATACACACGGGGCTGGCC
GAGGAGATCATCAAACACACGCGCACCGATCAATTCAAAGGCCTCCTCGAGGTGCAGCAGAATCTAGCCGCCGGC
GCGGACCCATCGTCTCAATACGACTGCATCGAGGAGCTCATCGCCCGCGACACGCCGCTGCGGGAAACCCTGCGG
CTGCTGTGCATCTACTCTTGCATATCCGGGGGCGTCAAGCCCAAGGAGTACGATAGTTTTCGGCGCCTGATCCTC
CAAGGCTACGGTTACCAACACATCTTGACGCTGGCCAACCTCGAGAAGCTGCAGCTCTTCCTGTCCCGCTCGTCG
CCGCTAGCCGGTATGATTCCCATGACGGGCGGCGCCGCCAGCGGGAGCGGCAACAAGACCAACTACACGTATCTG
CGGAAGCAGCTCCGTCTGATCGTGGACGAGGTCCAAGAGGACGACCCCAACGACGTGTCGTACGTGTACAGCGGA
TACGCGCCGCTCTCGATCCGACTCGTCCAATGCGTGCTGCAGAAGCAATATCTTCTCTCCGTCACCAAGGGCAGC
GGCGGAGGCAGCACGGCCGCGACCGGGGTGGGGATGCAGGGCTGGCATGGCTTCGACGAGGCCGTCAAACATGTG
CGCGGGCAGACGTTCTACGAGCTCCAGAAGGGCGAAGACAAGGCCGTCAAGGCACGCGCCCTGCTGTCTGGGGGT
GGCCAGAAACAAACAGTCTTCGTCGTCTTCGTGGGCGGCATCACCTTCACCGAGATTGCCGCGCTTCGCTTCCTG
GCCAAGCAAGAGGAGAGTAAGTCGGGCGCACCCCTCCCCAAACGGCCCCTCGCGGCCCCGGACCCCGTTCATTCT
AACCGGATCGCCAGGCCGCCGGAATATCGTCATTTGCACCACCTCCATCATTAGCGGTAACAGGATGATGGATGC
AGCTATCGAGAGGGACTCATTCGCGAGGCGGGCAGGGACCGGCGCCTCAAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail