Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9946
Gene name
LocationContig_763:6637..9773
Strand-
Gene length (bp)3136
Transcript length (bp)2991
Coding sequence length (bp)2991
Protein length (aa) 997

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.8E-13 243 371
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 2.1E-67 512 813
PF04433 SWIRM SWIRM domain 2.0E-11 134 212
PF00505 HMG_box HMG (high mobility group) box 8.3E-08 878 948
PF09011 HMG_box_2 HMG-box domain 8.2E-08 874 946
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.0E-07 238 324

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 130 818 2.0E-88
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 130 818 1.0E-87
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 153 818 3.0E-81
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 491 813 2.0E-61
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 512 813 1.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 130 818 2.0E-88
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 130 818 1.0E-87
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 153 818 3.0E-81
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 491 813 2.0E-61
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 512 813 1.0E-60
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 496 815 3.0E-60
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 508 812 1.0E-59
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 508 815 2.0E-59
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 508 812 9.0E-59
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 488 815 1.0E-57
sp|F4JLS1|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1 509 816 3.0E-55
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 497 811 2.0E-40
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 507 812 4.0E-36
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 509 811 1.0E-34
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 514 809 3.0E-34
sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 507 812 2.0E-33
sp|Q10135|LSD2_SCHPO Lysine-specific histone demethylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd2 PE=1 SV=1 112 378 3.0E-31
sp|Q9Y802|LSD1_SCHPO Lysine-specific histone demethylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd1 PE=1 SV=1 483 994 4.0E-30
sp|Q9Y802|LSD1_SCHPO Lysine-specific histone demethylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd1 PE=1 SV=1 108 384 3.0E-28
sp|Q21988|AMX1_CAEEL Amine oxidase family member 1 OS=Caenorhabditis elegans GN=amx-1 PE=3 SV=3 515 816 3.0E-28
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 595 839 3.0E-27
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 581 813 9.0E-27
sp|Q8C0L6|PAOX_MOUSE Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Mus musculus GN=Paox PE=1 SV=3 550 809 2.0E-23
sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 550 813 8.0E-23
sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 550 825 2.0E-22
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 160 392 7.0E-21
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 159 377 2.0E-20
sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 526 814 1.0E-19
sp|Q10135|LSD2_SCHPO Lysine-specific histone demethylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd2 PE=1 SV=1 564 988 1.0E-18
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 153 377 1.0E-18
sp|Q9XWP6|LSD1_CAEEL Probable lysine-specific histone demethylase 1 OS=Caenorhabditis elegans GN=spr-5 PE=1 SV=1 573 818 2.0E-18
sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 595 814 4.0E-17
sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 594 814 4.0E-17
sp|P31225|CBP1_CANAL Corticosteroid-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBP1 PE=1 SV=2 549 817 2.0E-15
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 161 377 5.0E-13
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 159 377 1.0E-12
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 159 377 1.0E-12
sp|P50264|FMS1_YEAST Polyamine oxidase FMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMS1 PE=1 SV=1 558 812 1.0E-11
sp|O96566|A37C_DROSI Protein anon-37Cs (Fragment) OS=Drosophila simulans GN=anon-37Cs PE=3 SV=1 558 814 7.0E-11
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 161 377 2.0E-10
sp|Q21988|AMX1_CAEEL Amine oxidase family member 1 OS=Caenorhabditis elegans GN=amx-1 PE=3 SV=3 161 373 3.0E-10
sp|P18487|A37C_DROME Protein anon-37Cs OS=Drosophila melanogaster GN=anon-37Cs PE=2 SV=3 558 814 3.0E-10
sp|Q4JHE3|OXLA_OXYSC L-amino-acid oxidase OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 548 819 3.0E-09
sp|Q4F867|OXLA_DABSI L-amino-acid oxidase (Fragments) OS=Daboia siamensis PE=1 SV=2 559 812 1.0E-08
sp|Q4JHE1|OXLA_PSEAU L-amino-acid oxidase OS=Pseudechis australis PE=1 SV=1 548 812 1.0E-08
sp|P56560|AOFB_BOVIN Amine oxidase [flavin-containing] B OS=Bos taurus GN=MAOB PE=1 SV=4 550 816 1.0E-08
sp|G8XQX1|OXLA_DABRR L-amino-acid oxidase OS=Daboia russelii PE=1 SV=1 559 812 1.0E-08
sp|J7H670|OXLA_LACMT L-amino acid oxidase Lm29 OS=Lachesis muta PE=1 SV=1 559 834 2.0E-08
sp|A8QL52|OXLA_BUNFA L-amino-acid oxidase OS=Bungarus fasciatus PE=1 SV=1 609 819 2.0E-08
sp|O96570|A37C_DROLE Protein anon-37Cs OS=Drosophila lebanonensis GN=anon-37Cs PE=3 SV=1 558 814 3.0E-08
sp|Q6STF1|OXLA_GLOHA L-amino-acid oxidase OS=Gloydius halys PE=1 SV=1 548 812 3.0E-08
sp|B5U6Y8|OXLA_ECHOC L-amino-acid oxidase OS=Echis ocellatus PE=1 SV=1 534 815 8.0E-08
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 159 377 9.0E-08
sp|P81382|OXLA_CALRH L-amino-acid oxidase OS=Calloselasma rhodostoma PE=1 SV=2 559 812 9.0E-08
sp|Q4JHE2|OXLA_NOTSC L-amino-acid oxidase OS=Notechis scutatus scutatus PE=2 SV=1 548 819 9.0E-08
sp|Q90W54|OXLA_GLOBL L-amino-acid oxidase OS=Gloydius blomhoffii PE=1 SV=1 548 812 9.0E-08
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 548 819 2.0E-07
sp|Q54IT3|AOFA_DICDI Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum GN=maoA PE=3 SV=1 551 817 3.0E-07
sp|K9N7B7|OXLA_CRODM L-amino acid oxidase Cdc18 (Fragment) OS=Crotalus durissus cumanensis PE=1 SV=1 559 819 4.0E-07
sp|A0A024BTN9|OXLA_BOTSC L-amino acid oxidase Bs29 (Fragment) OS=Bothriechis schlegelii PE=1 SV=1 559 819 4.0E-07
sp|P56742|OXLA_CROAT L-amino-acid oxidase OS=Crotalus atrox PE=1 SV=2 559 819 6.0E-07
sp|F8S0Z5|OXLA2_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 559 819 6.0E-07
sp|Q6PLK3|AOFB_PIG Amine oxidase [flavin-containing] B OS=Sus scrofa GN=MAOB PE=2 SV=3 587 816 7.0E-07
sp|P0DI84|OXLA_VIPAA L-amino-acid oxidase OS=Vipera ammodytes ammodytes PE=1 SV=1 559 815 1.0E-06
sp|B5AR80|OXLA_BOTPA L-amino-acid oxidase (Fragment) OS=Bothrops pauloensis PE=1 SV=1 548 812 2.0E-06
sp|O93364|OXLA_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 559 819 2.0E-06
sp|Q5RE98|AOFB_PONAB Amine oxidase [flavin-containing] B OS=Pongo abelii GN=MAOB PE=2 SV=3 550 816 4.0E-06
sp|P27338|AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens GN=MAOB PE=1 SV=3 550 816 4.0E-06
sp|B0VXW0|OXLA_SISCA L-amino-acid oxidase OS=Sistrurus catenatus edwardsii PE=2 SV=1 559 819 6.0E-06
sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 159 377 8.0E-06
sp|Q6NSN2|AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio GN=mao PE=1 SV=1 550 816 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005515 protein binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9946
MEDSPSQAGSEASPAADIGSDDEVPQAGGEDEQPASHQNDAVHSFTSSLSAMTELSDISSIQSNASSKATTPAEA
ETTRRQQSEERDRDPPCEPPSYRHSIEQLNFTVRPKSSIPTDIPSSRYASECIEAAESSRLNPYALHPEEYHLLR
HHISHAQVTTHLNIRNGILRIWMRRPWSGVTRQEAVGCANARWFDAASVCYDWLIRRGYINFGCVQLSEPSWIGA
DQPRVKRRKTVAVIGAGISGLACARHLEGLFKQYADRYHENGEDTPRVVLVEGRGRVGGRVYSREFKSKPVGDRP
EFPAQRHTAEMGGMIITGFDRGNPMNVLVRGQLGLPYHPLTADTTIYDSNGKPVDPGRDQLVEKLYNDCLDRVSE
FKFKPQPSKLIEGNRDLLHEGRDSLADGSKSIIQAEEAAAALPHAPPVSQQSVPEKVNMVPVSADKLTGRVHNEP
GTPATVKAADKAKLMGWSLRSAAASERNIDLGEAASLQGSTLGSVLDYAISQYKHLVDLSAQDHRLINWHVANLE
YSNATNLHNLSLALWDMDAGNEWEGQHTMIVGGYQSVARGLLQCPTALDLTTQFPVRKIKYHPDSFEGPAVLESE
NGTPIEADCVVCTVPLGVLKQGSVAFDPPLPPWKTGVIDRLGFGILNKVVLVYEKVFWEPERHIFGVLRDAPNRH
STAQKDYGANRGRFFQWFNVSNTTGLPCLIALMAGDAGFETEHSSNDQLIAEATDILRGVFGKDVPYPVESVVTR
WGSDRFARGSYSSAAAGMLPDDYDTMSRSVGNLFFAGEHTIGTHPATVHGAYLSGLRAAAEVLEAMIGPIEVPTP
LILPRDSLLLHKRKQAAEDPRTARLEAYEVEVSDYIRSKIGERPARPNKASGNAYLLYSKTHFEEAKKRCEESRK
PGRNRSLPNEVRVMTSKMWKDATPEERKPFEDEAAEQKRTYAAAMHEFTEESQKWDDKAAVLRAAYEKEHPSVPG
PDEVAQEAKMSQKHRRAKHVS*
Coding >Hirsu2|9946
ATGGAAGATTCGCCCTCTCAGGCTGGATCCGAAGCGTCTCCAGCCGCGGATATCGGTTCCGACGATGAAGTTCCT
CAAGCCGGTGGCGAGGATGAACAGCCTGCATCCCATCAAAATGATGCAGTTCACTCATTCACCTCGTCCTTGTCG
GCCATGACGGAACTTTCCGACATCTCGTCCATTCAGTCGAACGCTTCGAGCAAAGCTACGACCCCTGCCGAAGCC
GAGACGACACGACGTCAACAGAGCGAGGAGCGGGATCGAGATCCACCATGTGAACCGCCCTCGTATCGCCATAGC
ATCGAACAACTCAACTTCACCGTCCGGCCAAAATCTTCCATCCCAACCGACATCCCTTCTAGCCGGTATGCGAGC
GAGTGCATTGAGGCGGCCGAGTCCTCACGGTTGAATCCGTACGCGCTTCATCCAGAAGAATATCATTTGCTCCGG
CATCACATCTCACATGCCCAAGTCACGACGCACCTGAACATCAGGAACGGCATACTGCGTATCTGGATGAGGCGC
CCCTGGTCCGGCGTCACCCGGCAAGAGGCCGTCGGCTGTGCCAACGCCCGATGGTTTGATGCCGCAAGCGTCTGC
TACGACTGGCTCATTCGTCGTGGGTACATCAATTTTGGCTGTGTGCAGCTCTCCGAGCCCAGCTGGATTGGGGCT
GACCAGCCGCGGGTGAAGAGGCGGAAGACCGTTGCGGTCATCGGCGCTGGTATTTCCGGCCTGGCCTGCGCCAGG
CACCTGGAGGGGCTGTTCAAGCAGTATGCCGATCGGTATCACGAAAACGGGGAAGACACGCCGAGGGTCGTGCTC
GTGGAGGGGAGGGGTCGTGTAGGGGGCAGAGTGTACTCTCGCGAATTCAAGAGCAAACCTGTGGGCGATCGACCC
GAGTTCCCCGCCCAGAGACACACAGCCGAGATGGGCGGCATGATCATCACGGGTTTCGATCGCGGGAATCCCATG
AACGTCCTGGTTCGCGGGCAGCTCGGCTTGCCCTATCACCCTCTCACGGCCGACACAACCATATACGACAGCAAC
GGCAAGCCAGTAGACCCTGGCCGCGATCAGCTGGTCGAGAAGCTCTACAACGACTGTCTAGACCGGGTGAGCGAG
TTCAAGTTCAAGCCGCAGCCGTCAAAACTGATCGAGGGCAACCGCGATCTCCTGCACGAGGGCCGGGACAGCCTC
GCCGATGGGAGCAAGTCGATCATCCAGGCGGAGGAGGCGGCCGCGGCTCTTCCCCACGCACCGCCCGTCTCACAA
CAGAGCGTGCCGGAGAAGGTCAACATGGTTCCCGTCTCCGCCGACAAGCTGACGGGCCGCGTGCACAACGAGCCC
GGCACGCCGGCGACCGTCAAGGCGGCCGACAAGGCAAAGCTGATGGGCTGGAGCCTGAGGTCCGCGGCCGCGAGC
GAGCGCAACATCGACCTTGGCGAGGCCGCCTCGCTCCAAGGCTCGACCCTGGGCTCCGTACTCGACTACGCCATC
TCGCAGTACAAGCATCTGGTCGACCTGAGCGCTCAGGACCACCGCCTCATCAACTGGCACGTGGCCAATCTCGAG
TACAGCAACGCGACAAACCTGCATAACCTGAGCCTCGCACTGTGGGACATGGACGCCGGCAACGAGTGGGAGGGC
CAACACACCATGATCGTCGGGGGTTACCAGAGCGTCGCCCGTGGGCTGCTACAGTGTCCCACCGCGCTCGACTTG
ACGACTCAGTTCCCAGTGAGGAAGATCAAGTATCACCCAGACAGCTTCGAGGGGCCGGCCGTGCTCGAGTCGGAG
AACGGCACCCCCATAGAAGCAGACTGCGTCGTGTGCACCGTGCCACTGGGCGTGTTGAAGCAGGGCAGCGTGGCA
TTCGATCCTCCCTTGCCACCCTGGAAGACGGGCGTCATCGACCGACTCGGCTTTGGCATCCTCAATAAGGTCGTG
CTGGTCTACGAGAAGGTATTCTGGGAGCCCGAAAGACACATCTTTGGCGTTCTCCGGGACGCGCCCAACCGTCAC
AGCACGGCGCAAAAGGACTACGGCGCGAACCGGGGTCGCTTTTTCCAGTGGTTCAACGTTTCCAACACAACCGGC
CTGCCATGTCTCATCGCGCTCATGGCGGGAGACGCCGGCTTCGAGACGGAACACTCGAGCAACGATCAGCTCATC
GCCGAGGCCACGGACATCTTGAGAGGCGTGTTCGGCAAGGACGTCCCGTACCCGGTAGAGTCGGTCGTGACGCGC
TGGGGTTCCGACCGGTTCGCGCGCGGCAGCTACTCGTCCGCCGCTGCGGGCATGCTGCCCGACGACTACGATACC
ATGTCGAGGTCGGTGGGCAACTTGTTCTTCGCCGGCGAGCACACCATCGGAACGCATCCGGCGACCGTCCACGGC
GCGTACCTCTCGGGCCTGCGGGCGGCCGCCGAGGTCCTGGAGGCCATGATCGGCCCCATCGAGGTGCCGACGCCC
CTCATCCTCCCGAGAGACTCCCTCCTGCTGCACAAGCGCAAACAAGCGGCCGAGGACCCCCGGACGGCGCGGCTG
GAGGCATACGAGGTGGAGGTCAGCGACTACATCCGCTCCAAGATCGGCGAACGGCCGGCCCGGCCCAACAAGGCG
TCCGGGAACGCCTACCTCCTCTACAGCAAGACGCACTTCGAGGAGGCCAAGAAGCGATGCGAGGAGAGCCGGAAG
CCGGGCCGGAACCGAAGCCTGCCCAACGAGGTCCGCGTCATGACGTCCAAGATGTGGAAGGACGCGACGCCGGAG
GAGCGCAAGCCGTTCGAGGACGAGGCAGCCGAGCAGAAGCGGACCTACGCCGCCGCCATGCACGAGTTCACGGAA
GAGTCGCAGAAGTGGGACGACAAGGCCGCCGTCCTCCGGGCCGCCTACGAGAAGGAGCATCCTAGCGTCCCGGGC
CCGGACGAGGTCGCGCAGGAGGCCAAGATGTCACAGAAGCACCGCCGTGCCAAGCATGTAAGTTAG
Transcript >Hirsu2|9946
ATGGAAGATTCGCCCTCTCAGGCTGGATCCGAAGCGTCTCCAGCCGCGGATATCGGTTCCGACGATGAAGTTCCT
CAAGCCGGTGGCGAGGATGAACAGCCTGCATCCCATCAAAATGATGCAGTTCACTCATTCACCTCGTCCTTGTCG
GCCATGACGGAACTTTCCGACATCTCGTCCATTCAGTCGAACGCTTCGAGCAAAGCTACGACCCCTGCCGAAGCC
GAGACGACACGACGTCAACAGAGCGAGGAGCGGGATCGAGATCCACCATGTGAACCGCCCTCGTATCGCCATAGC
ATCGAACAACTCAACTTCACCGTCCGGCCAAAATCTTCCATCCCAACCGACATCCCTTCTAGCCGGTATGCGAGC
GAGTGCATTGAGGCGGCCGAGTCCTCACGGTTGAATCCGTACGCGCTTCATCCAGAAGAATATCATTTGCTCCGG
CATCACATCTCACATGCCCAAGTCACGACGCACCTGAACATCAGGAACGGCATACTGCGTATCTGGATGAGGCGC
CCCTGGTCCGGCGTCACCCGGCAAGAGGCCGTCGGCTGTGCCAACGCCCGATGGTTTGATGCCGCAAGCGTCTGC
TACGACTGGCTCATTCGTCGTGGGTACATCAATTTTGGCTGTGTGCAGCTCTCCGAGCCCAGCTGGATTGGGGCT
GACCAGCCGCGGGTGAAGAGGCGGAAGACCGTTGCGGTCATCGGCGCTGGTATTTCCGGCCTGGCCTGCGCCAGG
CACCTGGAGGGGCTGTTCAAGCAGTATGCCGATCGGTATCACGAAAACGGGGAAGACACGCCGAGGGTCGTGCTC
GTGGAGGGGAGGGGTCGTGTAGGGGGCAGAGTGTACTCTCGCGAATTCAAGAGCAAACCTGTGGGCGATCGACCC
GAGTTCCCCGCCCAGAGACACACAGCCGAGATGGGCGGCATGATCATCACGGGTTTCGATCGCGGGAATCCCATG
AACGTCCTGGTTCGCGGGCAGCTCGGCTTGCCCTATCACCCTCTCACGGCCGACACAACCATATACGACAGCAAC
GGCAAGCCAGTAGACCCTGGCCGCGATCAGCTGGTCGAGAAGCTCTACAACGACTGTCTAGACCGGGTGAGCGAG
TTCAAGTTCAAGCCGCAGCCGTCAAAACTGATCGAGGGCAACCGCGATCTCCTGCACGAGGGCCGGGACAGCCTC
GCCGATGGGAGCAAGTCGATCATCCAGGCGGAGGAGGCGGCCGCGGCTCTTCCCCACGCACCGCCCGTCTCACAA
CAGAGCGTGCCGGAGAAGGTCAACATGGTTCCCGTCTCCGCCGACAAGCTGACGGGCCGCGTGCACAACGAGCCC
GGCACGCCGGCGACCGTCAAGGCGGCCGACAAGGCAAAGCTGATGGGCTGGAGCCTGAGGTCCGCGGCCGCGAGC
GAGCGCAACATCGACCTTGGCGAGGCCGCCTCGCTCCAAGGCTCGACCCTGGGCTCCGTACTCGACTACGCCATC
TCGCAGTACAAGCATCTGGTCGACCTGAGCGCTCAGGACCACCGCCTCATCAACTGGCACGTGGCCAATCTCGAG
TACAGCAACGCGACAAACCTGCATAACCTGAGCCTCGCACTGTGGGACATGGACGCCGGCAACGAGTGGGAGGGC
CAACACACCATGATCGTCGGGGGTTACCAGAGCGTCGCCCGTGGGCTGCTACAGTGTCCCACCGCGCTCGACTTG
ACGACTCAGTTCCCAGTGAGGAAGATCAAGTATCACCCAGACAGCTTCGAGGGGCCGGCCGTGCTCGAGTCGGAG
AACGGCACCCCCATAGAAGCAGACTGCGTCGTGTGCACCGTGCCACTGGGCGTGTTGAAGCAGGGCAGCGTGGCA
TTCGATCCTCCCTTGCCACCCTGGAAGACGGGCGTCATCGACCGACTCGGCTTTGGCATCCTCAATAAGGTCGTG
CTGGTCTACGAGAAGGTATTCTGGGAGCCCGAAAGACACATCTTTGGCGTTCTCCGGGACGCGCCCAACCGTCAC
AGCACGGCGCAAAAGGACTACGGCGCGAACCGGGGTCGCTTTTTCCAGTGGTTCAACGTTTCCAACACAACCGGC
CTGCCATGTCTCATCGCGCTCATGGCGGGAGACGCCGGCTTCGAGACGGAACACTCGAGCAACGATCAGCTCATC
GCCGAGGCCACGGACATCTTGAGAGGCGTGTTCGGCAAGGACGTCCCGTACCCGGTAGAGTCGGTCGTGACGCGC
TGGGGTTCCGACCGGTTCGCGCGCGGCAGCTACTCGTCCGCCGCTGCGGGCATGCTGCCCGACGACTACGATACC
ATGTCGAGGTCGGTGGGCAACTTGTTCTTCGCCGGCGAGCACACCATCGGAACGCATCCGGCGACCGTCCACGGC
GCGTACCTCTCGGGCCTGCGGGCGGCCGCCGAGGTCCTGGAGGCCATGATCGGCCCCATCGAGGTGCCGACGCCC
CTCATCCTCCCGAGAGACTCCCTCCTGCTGCACAAGCGCAAACAAGCGGCCGAGGACCCCCGGACGGCGCGGCTG
GAGGCATACGAGGTGGAGGTCAGCGACTACATCCGCTCCAAGATCGGCGAACGGCCGGCCCGGCCCAACAAGGCG
TCCGGGAACGCCTACCTCCTCTACAGCAAGACGCACTTCGAGGAGGCCAAGAAGCGATGCGAGGAGAGCCGGAAG
CCGGGCCGGAACCGAAGCCTGCCCAACGAGGTCCGCGTCATGACGTCCAAGATGTGGAAGGACGCGACGCCGGAG
GAGCGCAAGCCGTTCGAGGACGAGGCAGCCGAGCAGAAGCGGACCTACGCCGCCGCCATGCACGAGTTCACGGAA
GAGTCGCAGAAGTGGGACGACAAGGCCGCCGTCCTCCGGGCCGCCTACGAGAAGGAGCATCCTAGCGTCCCGGGC
CCGGACGAGGTCGCGCAGGAGGCCAAGATGTCACAGAAGCACCGCCGTGCCAAGCATGTAAGTTAG
Gene >Hirsu2|9946
ATGGAAGATTCGCCCTCTCAGGCTGGATCCGAAGCGTCTCCAGCCGCGGATATCGGTTCCGAGTATGTTTAACCT
ATTCCTCACTCTGCTTCTTTGTCCTTCTTTGTTTTCTTTTCTTTCTTCTCTCCTCTTTGTCGGTCCAGAGCGTCG
TGAGCCGAGCTTCGGGCGTGTCACTTCCTCGCTCACTGTTTGCTAACATCTGGCTAGCGATGAAGTTCCTCAAGC
CGGTGGCGAGGATGAACAGCCTGCATCCCATCAAAATGATGCAGTTCACTCATTCACCTCGTCCTTGTCGGCCAT
GACGGAACTTTCCGACATCTCGTCCATTCAGTCGAACGCTTCGAGCAAAGCTACGACCCCTGCCGAAGCCGAGAC
GACACGACGTCAACAGAGCGAGGAGCGGGATCGAGATCCACCATGTGAACCGCCCTCGTATCGCCATAGCATCGA
ACAACTCAACTTCACCGTCCGGCCAAAATCTTCCATCCCAACCGACATCCCTTCTAGCCGGTATGCGAGCGAGTG
CATTGAGGCGGCCGAGTCCTCACGGTTGAATCCGTACGCGCTTCATCCAGAAGAATATCATTTGCTCCGGCATCA
CATCTCACATGCCCAAGTCACGACGCACCTGAACATCAGGAACGGCATACTGCGTATCTGGATGAGGCGCCCCTG
GTCCGGCGTCACCCGGCAAGAGGCCGTCGGCTGTGCCAACGCCCGATGGTTTGATGCCGCAAGCGTCTGCTACGA
CTGGCTCATTCGTCGTGGGTACATCAATTTTGGCTGTGTGCAGCTCTCCGAGCCCAGCTGGATTGGGGCTGACCA
GCCGCGGGTGAAGAGGCGGAAGACCGTTGCGGTCATCGGCGCTGGTATTTCCGGCCTGGCCTGCGCCAGGCACCT
GGAGGGGCTGTTCAAGCAGTATGCCGATCGGTATCACGAAAACGGGGAAGACACGCCGAGGGTCGTGCTCGTGGA
GGGGAGGGGTCGTGTAGGGGGCAGAGTGTACTCTCGCGAATTCAAGAGCAAACCTGTGGGCGATCGACCCGAGTT
CCCCGCCCAGAGACACACAGCCGAGATGGGCGGCATGATCATCACGGGTTTCGATCGCGGGAATCCCATGAACGT
CCTGGTTCGCGGGCAGCTCGGCTTGCCCTATCACCCTCTCACGGCCGACACAACCATATACGACAGCAACGGCAA
GCCAGTAGACCCTGGCCGCGATCAGCTGGTCGAGAAGCTCTACAACGACTGTCTAGACCGGGTGAGCGAGTTCAA
GTTCAAGCCGCAGCCGTCAAAACTGATCGAGGGCAACCGCGATCTCCTGCACGAGGGCCGGGACAGCCTCGCCGA
TGGGAGCAAGTCGATCATCCAGGCGGAGGAGGCGGCCGCGGCTCTTCCCCACGCACCGCCCGTCTCACAACAGAG
CGTGCCGGAGAAGGTCAACATGGTTCCCGTCTCCGCCGACAAGCTGACGGGCCGCGTGCACAACGAGCCCGGCAC
GCCGGCGACCGTCAAGGCGGCCGACAAGGCAAAGCTGATGGGCTGGAGCCTGAGGTCCGCGGCCGCGAGCGAGCG
CAACATCGACCTTGGCGAGGCCGCCTCGCTCCAAGGCTCGACCCTGGGCTCCGTACTCGACTACGCCATCTCGCA
GTACAAGCATCTGGTCGACCTGAGCGCTCAGGACCACCGCCTCATCAACTGGCACGTGGCCAATCTCGAGTACAG
CAACGCGACAAACCTGCATAACCTGAGCCTCGCACTGTGGGACATGGACGCCGGCAACGAGTGGGAGGGCCAACA
CACCATGATCGTCGGGGGTTACCAGAGCGTCGCCCGTGGGCTGCTACAGTGTCCCACCGCGCTCGACTTGACGAC
TCAGTTCCCAGTGAGGAAGATCAAGTATCACCCAGACAGCTTCGAGGGGCCGGCCGTGCTCGAGTCGGAGAACGG
CACCCCCATAGAAGCAGACTGCGTCGTGTGCACCGTGCCACTGGGCGTGTTGAAGCAGGGCAGCGTGGCATTCGA
TCCTCCCTTGCCACCCTGGAAGACGGGCGTCATCGACCGACTCGGCTTTGGCATCCTCAATAAGGTCGTGCTGGT
CTACGAGAAGGTATTCTGGGAGCCCGAAAGACACATCTTTGGCGTTCTCCGGGACGCGCCCAACCGTCACAGCAC
GGCGCAAAAGGACTACGGCGCGAACCGGGGTCGCTTTTTCCAGTGGTTCAACGTTTCCAACACAACCGGCCTGCC
ATGTCTCATCGCGCTCATGGCGGGAGACGCCGGCTTCGAGACGGAACACTCGAGCAACGATCAGCTCATCGCCGA
GGCCACGGACATCTTGAGAGGCGTGTTCGGCAAGGACGTCCCGTACCCGGTAGAGTCGGTCGTGACGCGCTGGGG
TTCCGACCGGTTCGCGCGCGGCAGCTACTCGTCCGCCGCTGCGGGCATGCTGCCCGACGACTACGATACCATGTC
GAGGTCGGTGGGCAACTTGTTCTTCGCCGGCGAGCACACCATCGGAACGCATCCGGCGACCGTCCACGGCGCGTA
CCTCTCGGGCCTGCGGGCGGCCGCCGAGGTCCTGGAGGCCATGATCGGCCCCATCGAGGTGCCGACGCCCCTCAT
CCTCCCGAGAGACTCCCTCCTGCTGCACAAGCGCAAACAAGCGGCCGAGGACCCCCGGACGGCGCGGCTGGAGGC
ATACGAGGTGGAGGTCAGCGACTACATCCGCTCCAAGATCGGCGAACGGCCGGCCCGGCCCAACAAGGCGTCCGG
GAACGCCTACCTCCTCTACAGCAAGACGCACTTCGAGGAGGCCAAGAAGCGATGCGAGGAGAGCCGGAAGCCGGG
CCGGAACCGAAGCCTGCCCAACGAGGTCCGCGTCATGACGTCCAAGATGTGGAAGGACGCGACGCCGGAGGAGCG
CAAGCCGTTCGAGGACGAGGCAGCCGAGCAGAAGCGGACCTACGCCGCCGCCATGCACGAGTTCACGGAAGAGTC
GCAGAAGTGGGACGACAAGGCCGCCGTCCTCCGGGCCGCCTACGAGAAGGAGCATCCTAGCGTCCCGGGCCCGGA
CGAGGTCGCGCAGGAGGCCAAGATGTCACAGAAGCACCGCCGTGCCAAGCATGTAAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail