Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9931
Gene name
LocationContig_76:40318..40955
Strand+
Gene length (bp)637
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 1.7E-08 22 82

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0008324 cation transmembrane transporter activity No
GO:0008150 biological_process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0006812 cation transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 65 87 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9931
MKQQQAGIIEAKVAIKRADVSVLQGRSIIVFTVFTIFFLPLSFFASIFGMNTAELNGGLMPLAKQLTYMFSLSGA
LILFSLSVAFSAWVRAVIAVPSGLIKSYLTYWMGLHDVVTTNIKALRDFETKKKDQLKDRYLKEQMVKIEEMIQK
AKADGEKSGNLHVV*
Coding >Hirsu2|9931
ATGAAACAGCAACAGGCCGGAATCATCGAGGCCAAGGTGGCCATCAAGCGCGCCGACGTTTCAGTCCTACAAGGC
CGTTCGATTATCGTCTTTACCGTTTTCACCATCTTCTTTCTCCCTTTATCCTTCTTCGCGTCTATCTTCGGCATG
AACACGGCCGAGCTGAACGGAGGCTTGATGCCGCTGGCCAAGCAGCTGACCTACATGTTCTCCCTGTCCGGAGCC
CTCATTCTATTTTCTCTGTCCGTTGCCTTCAGTGCCTGGGTTCGAGCCGTTATTGCCGTCCCCTCCGGACTCATC
AAGTCATACTTGACGTATTGGATGGGGTTGCACGACGTCGTCACCACCAACATCAAGGCCTTGAGGGACTTTGAG
ACGAAGAAGAAAGACCAACTGAAGGATCGATACTTGAAAGAACAGATGGTCAAGATCGAAGAGATGATACAAAAG
GCCAAGGCCGACGGTGAAAAATCCGGCAATTTGCACGTGGTTTGA
Transcript >Hirsu2|9931
ATGAAACAGCAACAGGCCGGAATCATCGAGGCCAAGGTGGCCATCAAGCGCGCCGACGTTTCAGTCCTACAAGGC
CGTTCGATTATCGTCTTTACCGTTTTCACCATCTTCTTTCTCCCTTTATCCTTCTTCGCGTCTATCTTCGGCATG
AACACGGCCGAGCTGAACGGAGGCTTGATGCCGCTGGCCAAGCAGCTGACCTACATGTTCTCCCTGTCCGGAGCC
CTCATTCTATTTTCTCTGTCCGTTGCCTTCAGTGCCTGGGTTCGAGCCGTTATTGCCGTCCCCTCCGGACTCATC
AAGTCATACTTGACGTATTGGATGGGGTTGCACGACGTCGTCACCACCAACATCAAGGCCTTGAGGGACTTTGAG
ACGAAGAAGAAAGACCAACTGAAGGATCGATACTTGAAAGAACAGATGGTCAAGATCGAAGAGATGATACAAAAG
GCCAAGGCCGACGGTGAAAAATCCGGCAATTTGCACGTGGTTTGA
Gene >Hirsu2|9931
ATGAAACAGCAACAGGCCGGAATCATCGAGGCCAAGGTGGCCATCAAGCGCGCCGACGTTTCAGTCCTACAAGGC
CGTTCGATTATCGTCTTTACCGTTTTCACCATCTTCTTTGTAAGCGCTCCCCGCATAGAGTCCGCCCGCAGCCGA
GAAAAAGCCCGGGCTGGCGCTTACTGGAAGCCCTGCAGCTCCCTTTATCCTTCTTCGCGTCTATCTTCGGCATGA
ACACGGCCGAGCTGAACGGAGGCTTGATGCCGCTGGCCAAGCAGCTGACCTACATGTGTAAGTCAATTCTCCGTA
AAAGCCCTCTGACATTGACACGCTTCCCGAAAACTGATGCACGTGGAAAGTCTCCCTGTCCGGAGCCCTCATTCT
ATTTTCTCTGTCCGTTGCCTTCAGTGCCTGGGTTCGAGCCGTTATTGCCGTCCCCTCCGGACTCATCAAGTCATA
CTTGACGTATTGGATGGGGTTGCACGACGTCGTCACCACCAACATCAAGGCCTTGAGGGACTTTGAGACGAAGAA
GAAAGACCAACTGAAGGATCGATACTTGAAAGAACAGATGGTCAAGATCGAAGAGATGATACAAAAGGCCAAGGC
CGACGGTGAAAAATCCGGCAATTTGCACGTGGTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail