Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9927
Gene name
LocationContig_76:20538..24208
Strand+
Gene length (bp)3670
Transcript length (bp)3552
Coding sequence length (bp)3552
Protein length (aa) 1184

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03770 IPK Inositol polyphosphate kinase 4.0E-54 914 1132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12494|KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCS1 PE=1 SV=1 911 1145 7.0E-51
sp|Q8BWD2|IP6K3_MOUSE Inositol hexakisphosphate kinase 3 OS=Mus musculus GN=Ip6k3 PE=2 SV=1 909 1140 1.0E-33
sp|Q95221|IP6K2_RABIT Inositol hexakisphosphate kinase 2 OS=Oryctolagus cuniculus GN=IP6K2 PE=2 SV=1 914 1138 2.0E-33
sp|Q9R0U1|IP6K2_RAT Inositol hexakisphosphate kinase 2 OS=Rattus norvegicus GN=Ip6k2 PE=2 SV=2 914 1128 4.0E-33
sp|Q80V72|IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus GN=Ip6k2 PE=2 SV=2 914 1128 4.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12494|KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCS1 PE=1 SV=1 911 1145 7.0E-51
sp|Q8BWD2|IP6K3_MOUSE Inositol hexakisphosphate kinase 3 OS=Mus musculus GN=Ip6k3 PE=2 SV=1 909 1140 1.0E-33
sp|Q95221|IP6K2_RABIT Inositol hexakisphosphate kinase 2 OS=Oryctolagus cuniculus GN=IP6K2 PE=2 SV=1 914 1138 2.0E-33
sp|Q9R0U1|IP6K2_RAT Inositol hexakisphosphate kinase 2 OS=Rattus norvegicus GN=Ip6k2 PE=2 SV=2 914 1128 4.0E-33
sp|Q80V72|IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus GN=Ip6k2 PE=2 SV=2 914 1128 4.0E-33
sp|Q9UHH9|IP6K2_HUMAN Inositol hexakisphosphate kinase 2 OS=Homo sapiens GN=IP6K2 PE=1 SV=2 914 1128 2.0E-32
sp|Q96PC2|IP6K3_HUMAN Inositol hexakisphosphate kinase 3 OS=Homo sapiens GN=IP6K3 PE=1 SV=2 914 1140 2.0E-30
sp|Q9ESM0|IP6K1_RAT Inositol hexakisphosphate kinase 1 OS=Rattus norvegicus GN=Ip6k1 PE=2 SV=1 881 1142 4.0E-30
sp|Q6PD10|IP6K1_MOUSE Inositol hexakisphosphate kinase 1 OS=Mus musculus GN=Ip6k1 PE=2 SV=1 881 1052 2.0E-29
sp|Q92551|IP6K1_HUMAN Inositol hexakisphosphate kinase 1 OS=Homo sapiens GN=IP6K1 PE=1 SV=3 895 1142 2.0E-29
sp|O74561|YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.08 PE=1 SV=1 470 703 2.0E-25
sp|Q12494|KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCS1 PE=1 SV=1 463 678 1.0E-19
sp|Q8NFU5|IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens GN=IPMK PE=1 SV=1 914 1053 2.0E-13
sp|Q7TT16|IPMK_MOUSE Inositol polyphosphate multikinase OS=Mus musculus GN=Ipmk PE=1 SV=1 914 1053 3.0E-13
sp|Q99NI4|IPMK_RAT Inositol polyphosphate multikinase OS=Rattus norvegicus GN=Ipmk PE=2 SV=1 914 1053 5.0E-13
sp|Q95221|IP6K2_RABIT Inositol hexakisphosphate kinase 2 OS=Oryctolagus cuniculus GN=IP6K2 PE=2 SV=1 471 537 9.0E-07
sp|Q9R0U1|IP6K2_RAT Inositol hexakisphosphate kinase 2 OS=Rattus norvegicus GN=Ip6k2 PE=2 SV=2 471 537 3.0E-06
sp|Q9ESM0|IP6K1_RAT Inositol hexakisphosphate kinase 1 OS=Rattus norvegicus GN=Ip6k1 PE=2 SV=1 471 535 4.0E-06
sp|Q9UHH9|IP6K2_HUMAN Inositol hexakisphosphate kinase 2 OS=Homo sapiens GN=IP6K2 PE=1 SV=2 471 537 4.0E-06
sp|Q92551|IP6K1_HUMAN Inositol hexakisphosphate kinase 1 OS=Homo sapiens GN=IP6K1 PE=1 SV=3 471 535 4.0E-06
sp|Q6PD10|IP6K1_MOUSE Inositol hexakisphosphate kinase 1 OS=Mus musculus GN=Ip6k1 PE=2 SV=1 471 535 4.0E-06
sp|Q9FLT2|IPMKB_ARATH Inositol polyphosphate multikinase beta OS=Arabidopsis thaliana GN=IPK2b PE=1 SV=1 915 1053 8.0E-06
sp|P07250|IPMK_YEAST Inositol polyphosphate multikinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG82 PE=1 SV=1 907 1052 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0032958 inositol phosphate biosynthetic process Yes
GO:0016301 kinase activity Yes
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:1901615 organic hydroxy compound metabolic process No
GO:0009058 biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019751 polyol metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0046165 alcohol biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043647 inositol phosphate metabolic process No
GO:0006066 alcohol metabolic process No
GO:0046173 polyol biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6476 0.5814 0.1239 0.3001 0.1241 0.0031 0.1171 0.0642 0.0776 0.0029

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4717
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5236
Ophiocordyceps australis map64 (Brazil) OphauB2|2901
Ophiocordyceps camponoti-floridani Ophcf2|03755
Ophiocordyceps camponoti-rufipedis Ophun1|3298
Ophiocordyceps kimflemingae Ophio5|376
Ophiocordyceps subramaniannii Hirsu2|9927 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9927
MATLATIPVAGHEAATVPSSYNHSVLAHARDVLSTHHDLVNGSVSRPCTSLELDLTPSGPLPPRNFSHPASLDDP
TTPTKAASLEAAGSSSRILSAQRPRDASRAVRPSPHRPRAADQALVLASEKSEKAWSIGSRDGDAEDGLVEQSVA
EAMAGVEPNARSRKASYSLRFFKEGLPADDKSRRKDGKLAAQRDNKLPPTLEEEGPKATANEAPADGPALHVTQA
RPPSTVDAAAPRPTQPEDPPTNVEEAVPGRPASPPPSQPPQPLKPVGGDYPTTPRVPRETETGARRAAPQATEVE
EAVRESADSTPVRERHESSDAEGDADVESDADDSGEEKISSAVFLPHQEMPEARLSVGEGMDSVCTPRPRSLSQS
KTHPWLVKADEPEPEPEMHDKDEPAFGSPPHFRTREALVSRKGGDLSLGLPDEAPVDDELEVKRHVPPPRLPQAV
TQYDDHVHDHQHHTRKPLEVIELIPYKHQVGGHTTLWRFSRRAVCKQLNNRENEFYETIERYHRDLLPFLPRYIG
VLNVTFQKQSRRKSTAKKDEAAAADRKRVLEEARKEGVAKGHSSAPAEADGSGPIRQLVSTRVVSQSLANASLQI
PTVTFDDNRHILPRNLLQPTPPPEFYRRRSISSSKEYQPATDDPNAVPPRPPLDERPNSWGATTINKRLRNEVFN
DAFLKEPVEVQKHRRPHQRSIPRPTFQRLLRPSSSDPNLIQDTDGVGTAQGARDESRPQPQPQPQPRPQPPSAAA
RDGPSPADDGHDARLLGPAAHAAGVSVKDITGSSAPEPETLKSNPMAHKKKRRFSAGGLRRRPEDVRESRGSLKY
FEEADDADYKTNNGTAPSPAGQNAQDGDADADATPILEPVVVTETADRLEAQTLSLSSPTAEFRKIPRPINPKEA
KKEASARPDRVEYFLLLEDLTAGMKRPCMMDLKMGTRQYGVDASPKKQRSQQDKCRTTTSAELGVRICGLQVWNV
QTQSYEFQDKYFGRKVKAGQEFQAALRRFLYNGVDPESILRHIPLVLRKLAQLEQIVRGLRGYRFYAASLLMFYD
GETSDDGGYETMYDSTTDGATDTEETSRRRRKNRREIDFKVADFANSLTPLDKMDDKPCPPQHPDGPDGGFLKGL
GSLRRYFVRIQRDVRAELDLAVSHGLRGPRAKFGDGVEADGDCDGVGREEADEGQISV*
Coding >Hirsu2|9927
ATGGCCACACTCGCCACCATCCCCGTCGCCGGCCACGAGGCCGCCACCGTGCCCTCGTCCTACAACCACTCCGTC
CTGGCACACGCCCGAGACGTGCTTTCGACGCATCACGACCTTGTCAACGGATCCGTCAGCCGCCCCTGCACCTCG
CTTGAGCTGGATCTGACGCCGTCCGGCCCTCTGCCGCCGCGCAACTTTTCCCACCCCGCCTCGCTCGACGACCCG
ACCACGCCCACCAAGGCGGCATCGCTGGAAGCCGCCGGCTCATCATCCCGCATTCTTTCCGCCCAGAGGCCGCGC
GACGCCTCGAGGGCCGTCCGTCCGTCACCGCATCGCCCCCGGGCCGCCGACCAAGCCCTTGTTCTGGCGTCCGAA
AAGAGCGAGAAAGCCTGGTCCATCGGCTCGCGCGATGGCGACGCAGAGGACGGCCTGGTCGAGCAGTCCGTTGCC
GAAGCAATGGCCGGCGTCGAGCCCAACGCGCGAAGCCGCAAGGCCAGCTACAGTCTGCGCTTCTTCAAGGAGGGC
CTGCCCGCCGACGACAAGAGCCGCCGCAAGGACGGCAAGCTCGCCGCCCAGCGAGACAATAAGCTGCCGCCGACG
TTGGAGGAGGAAGGGCCCAAGGCCACGGCCAACGAGGCTCCGGCAGACGGGCCTGCCCTGCATGTCACGCAAGCC
AGGCCACCATCGACCGTCGACGCGGCGGCACCTCGTCCCACGCAGCCCGAGGACCCCCCTACCAACGTCGAAGAG
GCCGTGCCAGGCAGACCAGCCTCGCCGCCACCCTCGCAGCCGCCGCAGCCTCTGAAGCCGGTCGGCGGCGACTAC
CCGACGACGCCGCGGGTGCCTCGCGAGACAGAGACAGGGGCACGTCGTGCCGCTCCCCAAGCTACGGAAGTGGAG
GAGGCGGTGCGGGAATCAGCCGATAGTACGCCGGTCCGAGAGCGCCACGAGAGCTCCGACGCCGAAGGCGACGCC
GATGTCGAGTCGGACGCCGACGACTCCGGCGAGGAGAAGATCTCGTCGGCCGTGTTCCTCCCCCACCAGGAGATG
CCCGAGGCCCGCTTGAGCGTGGGTGAGGGCATGGACAGTGTCTGTACGCCGCGGCCGAGGTCGCTTTCGCAGAGT
AAGACGCATCCGTGGCTCGTCAAGGCCGATGAGCCCGAGCCCGAGCCCGAAATGCATGACAAGGACGAGCCGGCC
TTTGGCTCTCCTCCCCACTTTCGTACCCGTGAGGCCCTCGTGTCCCGCAAAGGCGGCGACCTGTCCCTGGGGCTG
CCCGACGAGGCTCCTGTGGACGACGAGCTGGAGGTGAAGAGACACGTGCCTCCCCCCCGGCTGCCCCAGGCCGTA
ACGCAGTACGACGACCACGTGCATGACCATCAGCACCACACCCGGAAGCCTCTGGAGGTCATCGAGCTCATCCCA
TACAAGCACCAGGTCGGCGGCCACACCACCTTGTGGCGATTCTCTCGCAGGGCCGTCTGTAAGCAGCTCAACAAT
AGGGAAAATGAGTTTTACGAGACCATCGAGAGATATCACCGTGACCTGCTCCCCTTCCTGCCTCGCTACATCGGC
GTGTTGAACGTGACGTTCCAGAAACAGTCGCGCCGGAAGAGCACGGCCAAGAAGGACGAGGCCGCCGCCGCCGAC
CGCAAGAGGGTGCTGGAGGAGGCTAGAAAGGAGGGCGTGGCAAAGGGGCACAGCAGTGCGCCGGCCGAGGCCGAC
GGCAGCGGGCCGATCCGCCAGCTGGTCTCTACCAGGGTCGTGAGCCAGTCTTTGGCCAACGCGAGCCTCCAGATC
CCGACGGTGACGTTCGACGACAACAGACACATTCTCCCGCGCAACCTCTTACAGCCTACGCCACCGCCCGAATTC
TACAGACGCCGCAGCATCTCCTCTTCCAAGGAGTACCAGCCCGCGACAGACGATCCGAACGCAGTCCCTCCGCGA
CCCCCTCTCGACGAAAGGCCCAATAGCTGGGGGGCCACGACGATCAACAAACGGCTGCGCAACGAAGTGTTCAAC
GATGCCTTTCTCAAGGAGCCCGTCGAGGTTCAGAAGCATAGACGGCCGCATCAGCGATCCATTCCTCGGCCAACG
TTCCAGCGCCTCCTCCGGCCGTCCAGCTCGGACCCGAACCTGATCCAGGACACGGATGGTGTTGGGACGGCGCAA
GGAGCTAGGGATGAGTCTCGGCCGCAGCCGCAGCCACAGCCGCAGCCGCGGCCGCAGCCGCCATCGGCCGCCGCA
CGTGATGGGCCTTCGCCGGCCGATGACGGCCACGACGCCCGCCTCCTGGGACCCGCAGCTCACGCGGCGGGCGTG
TCGGTCAAGGACATCACCGGGTCGAGCGCCCCGGAGCCGGAGACGTTGAAGTCCAATCCCATGGCCCACAAGAAG
AAACGTAGGTTCTCGGCAGGCGGACTTCGGCGAAGACCGGAGGATGTGCGCGAGTCGCGCGGGAGCCTCAAGTAT
TTTGAGGAGGCCGACGACGCAGACTACAAGACGAACAACGGCACTGCCCCTTCCCCGGCTGGCCAGAACGCGCAA
GACGGGGATGCCGACGCGGACGCGACGCCCATCTTGGAGCCGGTCGTCGTGACGGAAACGGCCGACAGGCTGGAA
GCGCAGACGCTCAGCCTGTCGAGCCCGACGGCCGAGTTCAGGAAGATACCGCGGCCGATCAACCCGAAGGAGGCC
AAGAAGGAGGCTTCGGCCCGGCCCGACCGAGTCGAGTACTTTTTGCTCCTGGAGGACCTGACGGCCGGCATGAAG
CGGCCCTGCATGATGGACCTCAAGATGGGGACGCGCCAGTACGGCGTCGACGCCTCGCCGAAGAAGCAGAGGTCC
CAGCAGGACAAGTGCAGGACCACGACGTCGGCCGAGCTGGGGGTGCGCATCTGCGGCCTGCAGGTGTGGAACGTG
CAGACGCAGAGCTACGAGTTCCAGGACAAGTACTTTGGCCGCAAGGTCAAGGCGGGACAGGAGTTCCAGGCCGCG
CTGCGGCGCTTCCTCTACAACGGCGTGGACCCCGAGAGCATCCTGCGGCACATCCCGTTGGTGCTGAGGAAGCTG
GCGCAGCTGGAGCAGATCGTCCGCGGCCTGCGCGGCTACCGCTTCTACGCCGCCAGCCTGCTCATGTTCTACGAC
GGCGAGACGTCCGACGACGGCGGCTACGAGACCATGTACGACTCGACGACGGACGGCGCCACCGACACGGAAGAG
ACGAGCCGCAGGAGGCGCAAGAACCGCCGAGAGATCGACTTCAAGGTGGCCGACTTCGCCAACAGCCTCACGCCG
CTCGACAAGATGGACGACAAGCCCTGCCCGCCGCAGCACCCGGACGGGCCCGACGGCGGGTTCCTAAAGGGCCTG
GGAAGCCTCCGGCGATATTTCGTGCGAATCCAGCGCGACGTGCGGGCAGAGCTAGACCTAGCGGTTTCGCACGGC
CTCCGCGGGCCCCGAGCCAAGTTCGGCGACGGCGTCGAGGCCGACGGTGATTGTGACGGCGTCGGCAGGGAGGAA
GCAGACGAGGGCCAAATCAGCGTATGA
Transcript >Hirsu2|9927
ATGGCCACACTCGCCACCATCCCCGTCGCCGGCCACGAGGCCGCCACCGTGCCCTCGTCCTACAACCACTCCGTC
CTGGCACACGCCCGAGACGTGCTTTCGACGCATCACGACCTTGTCAACGGATCCGTCAGCCGCCCCTGCACCTCG
CTTGAGCTGGATCTGACGCCGTCCGGCCCTCTGCCGCCGCGCAACTTTTCCCACCCCGCCTCGCTCGACGACCCG
ACCACGCCCACCAAGGCGGCATCGCTGGAAGCCGCCGGCTCATCATCCCGCATTCTTTCCGCCCAGAGGCCGCGC
GACGCCTCGAGGGCCGTCCGTCCGTCACCGCATCGCCCCCGGGCCGCCGACCAAGCCCTTGTTCTGGCGTCCGAA
AAGAGCGAGAAAGCCTGGTCCATCGGCTCGCGCGATGGCGACGCAGAGGACGGCCTGGTCGAGCAGTCCGTTGCC
GAAGCAATGGCCGGCGTCGAGCCCAACGCGCGAAGCCGCAAGGCCAGCTACAGTCTGCGCTTCTTCAAGGAGGGC
CTGCCCGCCGACGACAAGAGCCGCCGCAAGGACGGCAAGCTCGCCGCCCAGCGAGACAATAAGCTGCCGCCGACG
TTGGAGGAGGAAGGGCCCAAGGCCACGGCCAACGAGGCTCCGGCAGACGGGCCTGCCCTGCATGTCACGCAAGCC
AGGCCACCATCGACCGTCGACGCGGCGGCACCTCGTCCCACGCAGCCCGAGGACCCCCCTACCAACGTCGAAGAG
GCCGTGCCAGGCAGACCAGCCTCGCCGCCACCCTCGCAGCCGCCGCAGCCTCTGAAGCCGGTCGGCGGCGACTAC
CCGACGACGCCGCGGGTGCCTCGCGAGACAGAGACAGGGGCACGTCGTGCCGCTCCCCAAGCTACGGAAGTGGAG
GAGGCGGTGCGGGAATCAGCCGATAGTACGCCGGTCCGAGAGCGCCACGAGAGCTCCGACGCCGAAGGCGACGCC
GATGTCGAGTCGGACGCCGACGACTCCGGCGAGGAGAAGATCTCGTCGGCCGTGTTCCTCCCCCACCAGGAGATG
CCCGAGGCCCGCTTGAGCGTGGGTGAGGGCATGGACAGTGTCTGTACGCCGCGGCCGAGGTCGCTTTCGCAGAGT
AAGACGCATCCGTGGCTCGTCAAGGCCGATGAGCCCGAGCCCGAGCCCGAAATGCATGACAAGGACGAGCCGGCC
TTTGGCTCTCCTCCCCACTTTCGTACCCGTGAGGCCCTCGTGTCCCGCAAAGGCGGCGACCTGTCCCTGGGGCTG
CCCGACGAGGCTCCTGTGGACGACGAGCTGGAGGTGAAGAGACACGTGCCTCCCCCCCGGCTGCCCCAGGCCGTA
ACGCAGTACGACGACCACGTGCATGACCATCAGCACCACACCCGGAAGCCTCTGGAGGTCATCGAGCTCATCCCA
TACAAGCACCAGGTCGGCGGCCACACCACCTTGTGGCGATTCTCTCGCAGGGCCGTCTGTAAGCAGCTCAACAAT
AGGGAAAATGAGTTTTACGAGACCATCGAGAGATATCACCGTGACCTGCTCCCCTTCCTGCCTCGCTACATCGGC
GTGTTGAACGTGACGTTCCAGAAACAGTCGCGCCGGAAGAGCACGGCCAAGAAGGACGAGGCCGCCGCCGCCGAC
CGCAAGAGGGTGCTGGAGGAGGCTAGAAAGGAGGGCGTGGCAAAGGGGCACAGCAGTGCGCCGGCCGAGGCCGAC
GGCAGCGGGCCGATCCGCCAGCTGGTCTCTACCAGGGTCGTGAGCCAGTCTTTGGCCAACGCGAGCCTCCAGATC
CCGACGGTGACGTTCGACGACAACAGACACATTCTCCCGCGCAACCTCTTACAGCCTACGCCACCGCCCGAATTC
TACAGACGCCGCAGCATCTCCTCTTCCAAGGAGTACCAGCCCGCGACAGACGATCCGAACGCAGTCCCTCCGCGA
CCCCCTCTCGACGAAAGGCCCAATAGCTGGGGGGCCACGACGATCAACAAACGGCTGCGCAACGAAGTGTTCAAC
GATGCCTTTCTCAAGGAGCCCGTCGAGGTTCAGAAGCATAGACGGCCGCATCAGCGATCCATTCCTCGGCCAACG
TTCCAGCGCCTCCTCCGGCCGTCCAGCTCGGACCCGAACCTGATCCAGGACACGGATGGTGTTGGGACGGCGCAA
GGAGCTAGGGATGAGTCTCGGCCGCAGCCGCAGCCACAGCCGCAGCCGCGGCCGCAGCCGCCATCGGCCGCCGCA
CGTGATGGGCCTTCGCCGGCCGATGACGGCCACGACGCCCGCCTCCTGGGACCCGCAGCTCACGCGGCGGGCGTG
TCGGTCAAGGACATCACCGGGTCGAGCGCCCCGGAGCCGGAGACGTTGAAGTCCAATCCCATGGCCCACAAGAAG
AAACGTAGGTTCTCGGCAGGCGGACTTCGGCGAAGACCGGAGGATGTGCGCGAGTCGCGCGGGAGCCTCAAGTAT
TTTGAGGAGGCCGACGACGCAGACTACAAGACGAACAACGGCACTGCCCCTTCCCCGGCTGGCCAGAACGCGCAA
GACGGGGATGCCGACGCGGACGCGACGCCCATCTTGGAGCCGGTCGTCGTGACGGAAACGGCCGACAGGCTGGAA
GCGCAGACGCTCAGCCTGTCGAGCCCGACGGCCGAGTTCAGGAAGATACCGCGGCCGATCAACCCGAAGGAGGCC
AAGAAGGAGGCTTCGGCCCGGCCCGACCGAGTCGAGTACTTTTTGCTCCTGGAGGACCTGACGGCCGGCATGAAG
CGGCCCTGCATGATGGACCTCAAGATGGGGACGCGCCAGTACGGCGTCGACGCCTCGCCGAAGAAGCAGAGGTCC
CAGCAGGACAAGTGCAGGACCACGACGTCGGCCGAGCTGGGGGTGCGCATCTGCGGCCTGCAGGTGTGGAACGTG
CAGACGCAGAGCTACGAGTTCCAGGACAAGTACTTTGGCCGCAAGGTCAAGGCGGGACAGGAGTTCCAGGCCGCG
CTGCGGCGCTTCCTCTACAACGGCGTGGACCCCGAGAGCATCCTGCGGCACATCCCGTTGGTGCTGAGGAAGCTG
GCGCAGCTGGAGCAGATCGTCCGCGGCCTGCGCGGCTACCGCTTCTACGCCGCCAGCCTGCTCATGTTCTACGAC
GGCGAGACGTCCGACGACGGCGGCTACGAGACCATGTACGACTCGACGACGGACGGCGCCACCGACACGGAAGAG
ACGAGCCGCAGGAGGCGCAAGAACCGCCGAGAGATCGACTTCAAGGTGGCCGACTTCGCCAACAGCCTCACGCCG
CTCGACAAGATGGACGACAAGCCCTGCCCGCCGCAGCACCCGGACGGGCCCGACGGCGGGTTCCTAAAGGGCCTG
GGAAGCCTCCGGCGATATTTCGTGCGAATCCAGCGCGACGTGCGGGCAGAGCTAGACCTAGCGGTTTCGCACGGC
CTCCGCGGGCCCCGAGCCAAGTTCGGCGACGGCGTCGAGGCCGACGGTGATTGTGACGGCGTCGGCAGGGAGGAA
GCAGACGAGGGCCAAATCAGCGTATGA
Gene >Hirsu2|9927
ATGGCCACACTCGCCACCATCCCCGTCGCCGGCCACGAGGCCGCCACCGTGCCCTCGTCCTACAACCACTCCGTC
CTGGCACACGCCCGAGACGTGCTTTCGACGCATCACGACCTTGTCAACGGATCCGTCAGCCGCCCCTGCACCTCG
CTTGAGCTGGATCTGACGCCGTCCGGCCCTCTGCCGCCGCGCAACTTTTCCCACCCCGCCTCGCTCGACGACCCG
ACCACGCCCACCAAGGCGGCATCGCTGGAAGCCGCCGGCTCATCATCCCGCATTCTTTCCGCCCAGAGGCCGCGC
GACGCCTCGAGGGCCGTCCGTCCGTCACCGCATCGCCCCCGGGCCGCCGACCAAGCCCTTGTTCTGGCGTCCGAA
AAGAGCGAGAAAGCCTGGTCCATCGGCTCGCGCGATGGCGACGCAGAGGACGGCCTGGTCGAGCAGTCCGTTGCC
GAAGCAATGGCCGGCGTCGAGCCCAACGCGCGAAGCCGCAAGGCCAGCTACAGTCTGCGCTTCTTCAAGGAGGGC
CTGCCCGCCGACGACAAGAGCCGCCGCAAGGACGGCAAGCTCGCCGCCCAGCGAGACAATAAGCTGCCGCCGACG
TTGGAGGAGGAAGGGCCCAAGGCCACGGCCAACGAGGCTCCGGCAGACGGGCCTGCCCTGCATGTCACGCAAGCC
AGGCCACCATCGACCGTCGACGCGGCGGCACCTCGTCCCACGCAGCCCGAGGACCCCCCTACCAACGTCGAAGAG
GCCGTGCCAGGCAGACCAGCCTCGCCGCCACCCTCGCAGCCGCCGCAGCCTCTGAAGCCGGTCGGCGGCGACTAC
CCGACGACGCCGCGGGTGCCTCGCGAGACAGAGACAGGGGCACGTCGTGCCGCTCCCCAAGCTACGGAAGTGGAG
GAGGCGGTGCGGGAATCAGCCGATAGTACGCCGGTCCGAGAGCGCCACGAGAGCTCCGACGCCGAAGGCGACGCC
GATGTCGAGTCGGACGCCGACGACTCCGGCGAGGAGAAGATCTCGTCGGCCGTGTTCCTCCCCCACCAGGAGATG
CCCGAGGCCCGCTTGAGCGTGGGTGAGGGCATGGACAGTGTCTGTACGCCGCGGCCGAGGTCGCTTTCGCAGAGT
AAGACGCATCCGTGGCTCGTCAAGGCCGATGAGCCCGAGCCCGAGCCCGAAATGCATGACAAGGACGAGCCGGCC
TTTGGCTCTCCTCCCCACTTTCGTACCCGTGAGGCCCTCGTGTCCCGCAAAGGCGGCGACCTGTCCCTGGGGCTG
CCCGACGAGGCTCCTGTGGACGACGAGCTGGAGGTGAAGAGACACGTGCCTCCCCCCCGGCTGCCCCAGGCCGTA
ACGCAGTACGACGACCACGTGCATGACCATCAGCACCACACCCGGAAGCCTCTGGAGGTCATCGAGCTCATCCCA
TACAAGCACCAGGTCGGCGGCCACACCACCTTGTGGCGATTCTCTCGCAGGGCCGTCTGTAAGCAGCTCAACAAT
AGGGAAAATGAGTTTTACGAGACCATCGAGAGATATCACCGTGACCTGCTCCCCTTCCTGCCTCGGTACGTTGTC
CAGCCATCCCCCTCCTCTCCCTCCCCCTCCTCATTGACTGGCTGCCGCCAGTGTGGCTGCATCCTGCAGGACTCC
GTTCTTCGTCGTGCTGACTACCCGGCTCTCAAGCTACATCGGCGTGTTGAACGTGACGTTCCAGAAACAGTCGCG
CCGGAAGAGCACGGCCAAGAAGGACGAGGCCGCCGCCGCCGACCGCAAGAGGGTGCTGGAGGAGGCTAGAAAGGA
GGGCGTGGCAAAGGGGCACAGCAGTGCGCCGGCCGAGGCCGACGGCAGCGGGCCGATCCGCCAGCTGGTCTCTAC
CAGGGTCGTGAGCCAGTCTTTGGCCAACGCGAGCCTCCAGATCCCGACGGTGACGTTCGACGACAACAGACACAT
TCTCCCGCGCAACCTCTTACAGCCTACGCCACCGCCCGAATTCTACAGACGCCGCAGCATCTCCTCTTCCAAGGA
GTACCAGCCCGCGACAGACGATCCGAACGCAGTCCCTCCGCGACCCCCTCTCGACGAAAGGCCCAATAGCTGGGG
GGCCACGACGATCAACAAACGGCTGCGCAACGAAGTGTTCAACGATGCCTTTCTCAAGGAGCCCGTCGAGGTTCA
GAAGCATAGACGGCCGCATCAGCGATCCATTCCTCGGCCAACGTTCCAGCGCCTCCTCCGGCCGTCCAGCTCGGA
CCCGAACCTGATCCAGGACACGGATGGTGTTGGGACGGCGCAAGGAGCTAGGGATGAGTCTCGGCCGCAGCCGCA
GCCACAGCCGCAGCCGCGGCCGCAGCCGCCATCGGCCGCCGCACGTGATGGGCCTTCGCCGGCCGATGACGGCCA
CGACGCCCGCCTCCTGGGACCCGCAGCTCACGCGGCGGGCGTGTCGGTCAAGGACATCACCGGGTCGAGCGCCCC
GGAGCCGGAGACGTTGAAGTCCAATCCCATGGCCCACAAGAAGAAACGTAGGTTCTCGGCAGGCGGACTTCGGCG
AAGACCGGAGGATGTGCGCGAGTCGCGCGGGAGCCTCAAGTATTTTGAGGAGGCCGACGACGCAGACTACAAGAC
GAACAACGGCACTGCCCCTTCCCCGGCTGGCCAGAACGCGCAAGACGGGGATGCCGACGCGGACGCGACGCCCAT
CTTGGAGCCGGTCGTCGTGACGGAAACGGCCGACAGGCTGGAAGCGCAGACGCTCAGCCTGTCGAGCCCGACGGC
CGAGTTCAGGAAGATACCGCGGCCGATCAACCCGAAGGAGGCCAAGAAGGAGGCTTCGGCCCGGCCCGACCGAGT
CGAGTACTTTTTGCTCCTGGAGGACCTGACGGCCGGCATGAAGCGGCCCTGCATGATGGACCTCAAGATGGGGAC
GCGCCAGTACGGCGTCGACGCCTCGCCGAAGAAGCAGAGGTCCCAGCAGGACAAGTGCAGGACCACGACGTCGGC
CGAGCTGGGGGTGCGCATCTGCGGCCTGCAGGTGTGGAACGTGCAGACGCAGAGCTACGAGTTCCAGGACAAGTA
CTTTGGCCGCAAGGTCAAGGCGGGACAGGAGTTCCAGGCCGCGCTGCGGCGCTTCCTCTACAACGGCGTGGACCC
CGAGAGCATCCTGCGGCACATCCCGTTGGTGCTGAGGAAGCTGGCGCAGCTGGAGCAGATCGTCCGCGGCCTGCG
CGGCTACCGCTTCTACGCCGCCAGCCTGCTCATGTTCTACGACGGCGAGACGTCCGACGACGGCGGCTACGAGAC
CATGTACGACTCGACGACGGACGGCGCCACCGACACGGAAGAGACGAGCCGCAGGAGGCGCAAGAACCGCCGAGA
GATCGACTTCAAGGTGGCCGACTTCGCCAACAGCCTCACGCCGCTCGACAAGATGGACGACAAGCCCTGCCCGCC
GCAGCACCCGGACGGGCCCGACGGCGGGTTCCTAAAGGGCCTGGGAAGCCTCCGGCGATATTTCGTGCGAATCCA
GCGCGACGTGCGGGCAGAGCTAGACCTAGCGGTTTCGCACGGCCTCCGCGGGCCCCGAGCCAAGTTCGGCGACGG
CGTCGAGGCCGACGGTGATTGTGACGGCGTCGGCAGGGAGGAAGCAGACGAGGGCCAAATCAGCGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail