Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9925
Gene name
LocationContig_76:4855..12993
Strand+
Gene length (bp)8138
Transcript length (bp)7788
Coding sequence length (bp)7788
Protein length (aa) 2596

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 6.0E-71 13 262
PF08659 KR KR domain 1.8E-59 2217 2393
PF00698 Acyl_transf_1 Acyl transferase domain 1.4E-44 572 917
PF14765 PS-DH Polyketide synthase dehydratase 1.4E-43 970 1280
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.7E-32 271 387
PF08242 Methyltransf_12 Methyltransferase domain 4.0E-18 1477 1581
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 1.8E-13 391 543
PF13649 Methyltransf_25 Methyltransferase domain 8.2E-12 1475 1579
PF08241 Methyltransf_11 Methyltransferase domain 7.6E-11 1477 1582
PF13489 Methyltransf_23 Methyltransferase domain 8.6E-09 1466 1609
PF13847 Methyltransf_31 Methyltransferase domain 1.5E-08 1471 1585
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.8E-08 1461 1591
PF00106 adh_short short chain dehydrogenase 1.8E-07 2220 2371

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 2581 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 4 1022 5.0E-162
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 4 1022 1.0E-159
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 10 1209 1.0E-154
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 11 1068 2.0E-151
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 2581 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 4 1022 5.0E-162
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 4 1022 1.0E-159
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 10 1209 1.0E-154
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 11 1068 2.0E-151
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 13 1198 2.0E-129
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 14 1161 9.0E-124
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 14 1161 4.0E-123
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 13 1239 1.0E-121
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 13 1239 2.0E-116
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 11 907 1.0E-111
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 11 907 2.0E-111
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 11 907 2.0E-111
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 13 1222 1.0E-110
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 13 1222 1.0E-110
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 13 1222 1.0E-110
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 13 1222 1.0E-110
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 13 1222 8.0E-110
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 13 907 3.0E-108
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 13 907 4.0E-108
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 6 955 7.0E-108
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 13 907 5.0E-107
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 13 1302 3.0E-106
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 13 1302 3.0E-106
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 14 1016 5.0E-102
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 13 1118 9.0E-101
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 13 1055 2.0E-99
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 10 1052 5.0E-98
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 14 1016 5.0E-97
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 13 982 5.0E-96
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 14 1057 7.0E-96
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 10 968 2.0E-95
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 10 968 2.0E-95
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 10 968 2.0E-95
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 14 1056 7.0E-95
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1 1053 2.0E-94
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 14 1225 3.0E-94
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 72 1016 7.0E-93
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 14 1016 1.0E-92
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 83 1016 1.0E-92
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 14 1087 5.0E-92
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 6 1016 4.0E-91
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 3 882 7.0E-90
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 14 1225 8.0E-90
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 14 1016 8.0E-89
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 13 953 2.0E-88
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 78 1053 3.0E-87
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 78 1160 4.0E-87
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 14 1219 6.0E-87
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 14 882 3.0E-86
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 14 1053 3.0E-86
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 14 1023 9.0E-86
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 78 1079 6.0E-85
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 7 1016 2.0E-84
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 78 1016 2.0E-83
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 7 1016 3.0E-83
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 14 953 4.0E-83
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 7 1016 4.0E-82
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 78 1017 4.0E-82
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 13 437 4.0E-82
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 13 437 4.0E-82
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 13 437 7.0E-82
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 8 1039 7.0E-82
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 78 1016 3.0E-81
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 78 1016 6.0E-80
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 13 434 2.0E-79
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 13 434 4.0E-79
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 78 834 2.0E-78
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 10 539 4.0E-75
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 13 447 8.0E-73
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 14 434 1.0E-72
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 14 436 4.0E-71
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 14 533 6.0E-71
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 13 427 1.0E-70
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 13 436 2.0E-70
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 14 436 3.0E-70
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2 446 1.0E-68
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 11 445 6.0E-68
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 11 436 5.0E-67
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1417 2586 3.0E-66
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 13 436 5.0E-65
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 5 442 2.0E-64
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 14 434 2.0E-64
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 14 434 5.0E-64
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 14 439 7.0E-61
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 14 533 8.0E-61
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 14 434 2.0E-59
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 14 434 4.0E-59
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 13 436 5.0E-59
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 78 445 9.0E-59
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 82 434 1.0E-58
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 14 380 2.0E-58
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 14 444 3.0E-57
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 14 436 2.0E-56
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 78 436 7.0E-56
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 14 436 8.0E-56
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1 434 2.0E-55
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 78 442 3.0E-54
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1436 2583 4.0E-54
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 14 448 2.0E-53
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 14 435 2.0E-52
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 11 435 1.0E-49
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 11 435 2.0E-48
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1430 2565 5.0E-45
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1856 2391 3.0E-42
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1856 2391 3.0E-42
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1436 2588 4.0E-41
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1358 1782 1.0E-40
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1436 2581 2.0E-40
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1436 2581 7.0E-40
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1435 2576 3.0E-39
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1436 2581 6.0E-39
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1436 2581 2.0E-38
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 549 1283 9.0E-38
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1436 2565 1.0E-37
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1436 2105 5.0E-37
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1877 2401 4.0E-36
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1417 2039 5.0E-36
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1877 2401 9.0E-36
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1877 2402 1.0E-35
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1854 2399 1.0E-35
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 570 1158 4.0E-35
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1927 2562 1.0E-34
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1431 2560 4.0E-34
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2210 2595 5.0E-34
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1972 2438 6.0E-33
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 572 1045 9.0E-32
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1856 2391 2.0E-31
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 570 961 5.0E-31
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 570 953 8.0E-31
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 551 1016 2.0E-30
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 572 1225 1.0E-29
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 571 1016 2.0E-29
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 570 1016 2.0E-29
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 571 1016 6.0E-29
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1900 2560 1.0E-28
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 571 1016 1.0E-28
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1510 2587 3.0E-28
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1436 2576 4.0E-28
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1436 2576 1.0E-27
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 2181 2586 3.0E-27
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1436 2577 3.0E-27
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 569 1204 5.0E-27
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 569 1204 5.0E-27
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 569 1204 5.0E-27
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 570 953 3.0E-26
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1888 2392 3.0E-26
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 572 1079 2.0E-25
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2210 2583 2.0E-24
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1852 2391 2.0E-24
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1852 2391 2.0E-24
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1852 2391 2.0E-24
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1852 2391 2.0E-24
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1852 2391 2.0E-24
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 572 1053 7.0E-24
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1503 2565 3.0E-23
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1865 2581 3.0E-23
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1900 2415 4.0E-23
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 572 1079 4.0E-23
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1527 2565 5.0E-23
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 2192 2435 6.0E-23
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1900 2560 9.0E-23
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 570 922 4.0E-22
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1855 2581 5.0E-22
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1901 2565 6.0E-22
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1853 2561 9.0E-22
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 2215 2586 9.0E-22
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 2215 2586 2.0E-21
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1865 2581 4.0E-21
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1865 2565 1.0E-20
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1855 2581 4.0E-20
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1422 1636 2.0E-19
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1865 2565 3.0E-19
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 571 834 3.0E-19
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 106 430 7.0E-19
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 1420 1633 1.0E-18
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 14 434 2.0E-18
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 182 430 3.0E-18
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 182 430 3.0E-18
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 182 430 3.0E-18
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1896 2586 4.0E-18
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 161 429 5.0E-18
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1896 2576 9.0E-18
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 158 429 1.0E-17
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 158 429 2.0E-17
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2176 2402 5.0E-17
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1436 1633 8.0E-17
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 161 429 2.0E-16
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 571 807 2.0E-16
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1896 2586 3.0E-16
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 158 429 5.0E-16
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 570 880 8.0E-16
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1430 1636 1.0E-15
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 160 434 1.0E-15
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 160 434 1.0E-15
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2232 2402 2.0E-15
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 2216 2586 2.0E-15
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 147 431 2.0E-15
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2216 2378 3.0E-15
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 182 430 6.0E-15
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 161 431 1.0E-14
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 120 434 1.0E-14
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 2199 2429 2.0E-14
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 161 431 3.0E-14
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1436 1633 4.0E-14
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1473 1633 4.0E-14
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 161 431 4.0E-14
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 161 431 4.0E-14
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 98 434 5.0E-14
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 161 429 8.0E-14
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 161 429 8.0E-14
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 161 429 8.0E-14
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 161 429 8.0E-14
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1473 1633 9.0E-14
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2233 2562 1.0E-13
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1772 2105 1.0E-13
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 2188 2586 2.0E-13
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 2188 2586 2.0E-13
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 2188 2586 2.0E-13
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1894 2104 2.0E-13
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1871 2085 2.0E-13
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 162 434 2.0E-13
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1894 2120 2.0E-13
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1894 2195 3.0E-13
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 39 139 3.0E-13
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 111 434 3.0E-13
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 570 808 3.0E-13
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 1436 1637 4.0E-13
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1871 2120 4.0E-13
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1436 1633 6.0E-13
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1877 2085 7.0E-13
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1871 2085 8.0E-13
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2233 2420 1.0E-12
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1473 1749 1.0E-12
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 161 431 2.0E-12
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1436 1636 3.0E-12
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1871 2175 3.0E-12
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 182 430 5.0E-12
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 14 429 5.0E-12
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 171 434 6.0E-12
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1877 2085 8.0E-12
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 161 440 1.0E-11
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2216 2378 2.0E-11
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 571 880 2.0E-11
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1892 2104 2.0E-11
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 570 836 4.0E-11
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 80 429 4.0E-11
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 84 434 4.0E-11
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 570 841 5.0E-11
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 167 434 5.0E-11
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 571 880 6.0E-11
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 568 874 6.0E-11
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 571 880 7.0E-11
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 571 880 7.0E-11
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1847 2046 8.0E-11
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1436 1636 8.0E-11
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 570 807 8.0E-11
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 2212 2392 9.0E-11
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 571 880 9.0E-11
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 571 880 9.0E-11
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 571 880 9.0E-11
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 2212 2392 1.0E-10
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 2212 2392 1.0E-10
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 14 437 2.0E-10
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1847 2046 3.0E-10
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 175 434 3.0E-10
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 182 430 4.0E-10
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 182 430 4.0E-10
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 182 430 4.0E-10
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 182 430 4.0E-10
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 570 784 4.0E-10
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 14 401 4.0E-10
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1871 2085 6.0E-10
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 162 434 7.0E-10
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1871 2085 8.0E-10
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 2216 2563 9.0E-10
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 162 434 1.0E-09
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 162 434 1.0E-09
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 162 434 1.0E-09
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 162 434 1.0E-09
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 162 434 1.0E-09
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 162 434 1.0E-09
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1401 1797 2.0E-09
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 2218 2378 2.0E-09
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2218 2378 2.0E-09
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 14 431 2.0E-09
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1900 2104 3.0E-09
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1877 2046 3.0E-09
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 14 437 7.0E-09
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 2201 2398 8.0E-09
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 2233 2413 2.0E-08
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 2233 2413 2.0E-08
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 2233 2413 2.0E-08
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 14 395 2.0E-08
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 2216 2369 2.0E-08
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 14 395 2.0E-08
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 570 838 3.0E-08
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 14 434 5.0E-08
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 14 434 6.0E-08
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1857 2045 1.0E-07
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 171 436 2.0E-07
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1869 2043 2.0E-07
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 568 896 6.0E-07
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 568 896 6.0E-07
sp|Q59A28|QORL1_BOVIN Quinone oxidoreductase-like protein 1 OS=Bos taurus GN=CRYZL1 PE=2 SV=1 1894 2081 7.0E-07
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1894 2042 9.0E-07
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 1894 2045 9.0E-07
sp|O95825|QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 1894 2081 1.0E-06
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 568 896 1.0E-06
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1900 2104 2.0E-06
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1945 2104 2.0E-06
sp|Q921W4|QORL1_MOUSE Quinone oxidoreductase-like protein 1 OS=Mus musculus GN=Cryzl1 PE=1 SV=1 1881 2081 2.0E-06
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1967 2034 3.0E-06
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1967 2034 4.0E-06
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 571 840 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9925
MDSLPQDGGPAAPLAVIGLAFEFPQGATSDEAFWQMLYEGRSASTDFPRSRLDIDAFYHPDKDRPSSIPLRGGHF
VDDDLAAFDAPFFSISAAEAACMDPQHRRMLETAYHALEDAGIPLGAFAGSDTAVYTGSFTNDYLALQQHDLQAE
RRHGAMGVAASMMANRLSWFFDLKGTSFNVDSACSSSLLALHLACQDLRAGNSSMALVGGANLVFHPGFMKLMSD
ANFLSVDGRCWSFDDRANGYARGEGIAVVLIKPLAHALRDGDTVRAVIRNTGSNQDGRTPGITQPNRQSQIDLIR
KTYQQAGVDMGPTRFFEAHATATPVGDPIEAGAIGASFRQHRSSSSPMHVGAVKANIGHLESCSGLAGLIKTILV
LERGVIPPIAGLQILNRQIDAENLHLHFPTKPVPWPPGDVRRACINSFGFGGTNVVAILDDASHHSRDKSLHGFH
RTEGKFSASQNGHAEPRTPSLISESTLNGFYPSDEPATRPSLLIWSAPDRAGAERLSHAYDDYIRRIDSLKLRNL
AYALAVKRTLFPWRSFTVAYPSSSNGDPGPPLFAKPTKATSRTGVAFVFTGQGAQYLGMGRRLLSFPVFRDSLGR
CEDCLRLFGCPWSLLDVVNGANDQIKMDQADISQPSTTCLQIALVDMLRDLGISPSMVTGHSSGEIAAAYCTGAL
SRSSAVKIAYYRGLLCSRLAAEVDDLAMLAVGLSKDQILPYLKCLHNVDNAVDVEIGCVNSPKNITLTGSASQLA
ALEDCLKRENIFARRLRVPLAYHSRFMTAIADRYAASIVGLEGADRPASSAPMVSSVTGDVVAPHILATAEYWVR
NLTSPVEFASAFNKVLAFATRTSRKRLGRGTLVDPQLSHVLEIGPHSALESSIRENLLSMEGVTKPAYMASLVRG
QDGSVTLLRAAAALFCAGHPVDLMRANGLHGDTRRQAPADMPRYPFNHQQKYWAESTLSSNFRFPGASRHDLFGA
RSPDWNPQVAQWRNVLRVAEVPWLEDHRIAGEIVFPAAGFVVMAIEALRQLLADTEPVLRGVIIHDVVFVHPIRI
LRGTPHVETQLTLSSQPHHLTRDTPSWTEFRIFVLDNGSYLECSRGFIRPIFDVEDQDRMVALGPWASETWRDRV
SSACRRSVEDPYEMPKENAVSYGPAFRCLENVCLGDQGEAMANINTGAWKSSGSVSASPDYGVHPTVMDGLAQLV
VPAVSQLRDNVQTMVPVRVNRIWLDLSRDDSRQGKITVRGECRLRGHRGAYANLVGTGPASGSPFIYLDGLETTF
IDNGQEKSIGQITVEPRKLCTHITWEPDIDFMSRQQLQVHCTRNRPPQRDGAVEAYKSLTLAIMAFIHEAVFRID
NPTPLVHLDRHLEAFAGWMGFQLQRLHRGDMLVDYDAVLTLLRDSDARWRLVSQVEDSGIDGLFFMQIGRNLGQI
LCGKVDPLGLMFENGLVDRYYEEMLANEHHAHPASAYVDLLCFKNPSMKIIEVGAGTGGQTLRLLEKMSSDGVQK
WARYDYTDISPSFFGQARLKLQAYGSRLDFRVCDISQDPVGQSFEAGAYDLVVASHVLHATNLLDESLRNVRKLL
KPGGKLFLFETTSPDAILAFAFGLLKGWWSPLDHEIRSPFSPCLSVEQWDDRLKRTGFSGIDLEIPGQAEPQTRY
SSFIVSTALHPSTIGRASTPQEFTVVADGCSRAQKDIANRLKTELSSDGRSCVVIELSHYSSIKSARLGTVIFLL
EVDSVFLDGMSEFEYLSMRSVMVRETSTLWVTRPPVPGATEPRHGLADGLGRVLMSEDASRKFVTLSLDGWDQDS
TYATLLISQLAERIAESPVEGLETKYTTLDGVLQIGRVRKDASMDSRIAKTLEPREKRQTRVVTDSSRLSLEIGM
PGNLETLEWTEDESVYGEPALNDDEVLVRVRAVGLTDRDYLVASGQLDDRDLGIECAGEVQAAGKNSGFRYGDRV
CLIATSTSRSTIRAKGETMVSIPSHWTFSEACSLASAAWTAHHALVNIARLREGESVLIHRAAKSEGQMAIQLAR
ELGAQVFVSVGSASEQELLRERLQIPDSNIFLISQGLSLLSEISRTTKTLGVDAIVGPLALDVDKIAFAECLAPL
GRLIDTCTCPRQTRADQAPVPHPTNVLVASVDMIDLLRKRPDLAYSSFRSAMEAAFGAPLQAPHPLDLFTANEVH
TAFRQGHDDRTGVSKRVIELNPDVSVTANFRTRPRYSFEAEATYVISGGLGGLGRSFARWMVSRGAKNLILMSRS
GASTASARALVHELISRDVHVETPKVDVGNLAEVQEMVRAFGSTMPPIRGCIQASVVLRDNLFPNMTYEDWVIST
KAKVAGSWNLHAALPRDLDFFILISSLNGIMGGRGQANYGAGNAFEDALAQHRVLSGQKAVSIDLGLMVAEGIVA
ENPQLLASMRRIGHLMDIRREELLALLDHYCDPDLPVLDPADAQILVGLELPDAVLAKGIDLHHSIRRPLFRHLF
QMGRGQSGGDESGASSVTAGLDRASMLASADSQAAAAALVVAWLAGKIGQILGLAEEDVDVARPAHTYSIDSLVA
IDLKNWFSREIGADMEIFTLLGNASLEQLAEQAAAKSRYRQQAEA*
Coding >Hirsu2|9925
ATGGACAGCCTGCCCCAGGACGGCGGACCCGCCGCCCCTCTGGCCGTCATTGGCCTCGCCTTCGAGTTCCCGCAG
GGAGCCACCTCGGACGAGGCCTTCTGGCAGATGCTATACGAAGGGCGGTCGGCCAGCACCGACTTTCCCCGCAGC
CGCCTCGATATCGATGCCTTCTACCACCCGGACAAGGACCGGCCGAGCTCGATCCCGCTGCGGGGCGGCCACTTC
GTCGACGACGACCTCGCCGCCTTCGACGCCCCCTTCTTCTCCATCTCGGCCGCCGAGGCGGCCTGCATGGACCCG
CAGCACCGGCGGATGCTCGAGACGGCCTACCACGCCCTCGAGGATGCCGGCATCCCCCTCGGCGCCTTTGCCGGC
TCCGACACTGCCGTCTACACCGGCAGCTTCACCAACGACTACCTCGCCCTCCAGCAGCACGACCTCCAGGCCGAG
CGGCGCCACGGCGCCATGGGCGTCGCCGCCTCCATGATGGCCAACCGCCTCAGCTGGTTCTTCGATCTCAAGGGC
ACCTCCTTCAACGTCGACTCGGCCTGCTCCAGCAGCCTGCTCGCTCTGCACCTTGCCTGCCAAGACCTGCGAGCC
GGCAACTCGTCCATGGCGCTCGTCGGCGGCGCGAACCTGGTCTTCCACCCCGGCTTCATGAAGCTCATGTCCGAC
GCCAACTTCCTCTCCGTCGACGGCCGTTGCTGGAGCTTCGACGACCGCGCCAACGGCTATGCCCGCGGCGAGGGC
ATCGCCGTCGTTCTTATCAAGCCCCTGGCCCACGCCCTGCGTGACGGCGACACCGTCCGAGCCGTCATTCGAAAC
ACCGGCTCAAACCAGGACGGTCGCACCCCCGGCATCACACAGCCCAACCGCCAGTCGCAGATCGACCTCATCCGA
AAGACCTACCAGCAGGCTGGCGTCGACATGGGCCCGACGCGCTTCTTCGAGGCCCATGCCACGGCCACTCCCGTT
GGCGACCCCATCGAGGCCGGCGCCATTGGTGCCTCGTTCCGGCAGCATCGCAGCTCTTCCAGTCCCATGCACGTC
GGTGCCGTGAAGGCCAACATAGGCCACCTCGAAAGCTGCAGTGGCCTCGCCGGTCTCATCAAAACCATACTTGTT
CTGGAGAGGGGGGTTATCCCCCCGATAGCCGGGCTTCAAATCCTGAATCGGCAAATCGATGCCGAGAATCTGCAT
CTTCATTTCCCGACTAAACCTGTCCCTTGGCCCCCAGGTGACGTTCGCCGGGCGTGTATTAATTCCTTTGGTTTT
GGTGGCACCAACGTGGTGGCTATCCTTGACGACGCTTCCCATCATTCAAGAGACAAAAGCCTCCACGGCTTTCAT
CGTACTGAGGGAAAGTTTTCCGCCAGCCAAAACGGACATGCTGAGCCCCGAACCCCATCTTTGATATCAGAATCA
ACGCTCAATGGCTTTTACCCGTCGGACGAGCCAGCCACGCGCCCGTCACTTCTTATTTGGTCTGCCCCTGATCGG
GCCGGAGCGGAGAGGCTGTCTCACGCCTATGATGACTACATTCGCCGCATAGATTCGCTCAAGCTGAGAAACTTG
GCATATGCCCTGGCCGTCAAGCGAACTCTGTTTCCATGGAGAAGCTTTACCGTTGCCTACCCAAGTAGCAGCAAT
GGCGACCCGGGGCCCCCCCTTTTCGCGAAGCCGACCAAAGCAACGAGCAGAACAGGCGTCGCGTTTGTATTCACC
GGCCAGGGAGCTCAGTATCTCGGTATGGGACGTCGTCTGCTCAGTTTTCCGGTGTTTCGGGACAGCCTCGGACGC
TGCGAGGATTGTCTTCGACTGTTTGGTTGTCCATGGTCGCTCCTGGACGTCGTCAACGGCGCAAATGATCAGATC
AAAATGGACCAAGCCGACATCAGCCAACCTTCTACGACGTGCCTTCAGATTGCCCTCGTAGACATGTTGCGTGAC
CTTGGAATCTCGCCATCTATGGTGACCGGACATTCATCCGGCGAGATTGCGGCCGCATATTGCACGGGTGCCCTA
TCACGTTCCTCTGCCGTCAAGATAGCCTACTACCGTGGACTCCTCTGCTCTCGGTTAGCAGCCGAAGTCGACGAC
TTGGCCATGCTGGCCGTGGGGCTTTCCAAGGATCAGATACTCCCCTACCTCAAGTGCCTGCACAACGTCGACAAC
GCAGTCGACGTGGAAATAGGCTGCGTAAACAGCCCAAAGAACATCACGTTGACTGGAAGTGCCTCGCAACTTGCC
GCACTGGAGGACTGTCTGAAGCGCGAAAACATTTTTGCTCGGCGACTCCGCGTGCCGCTGGCCTACCACTCACGC
TTCATGACAGCCATCGCTGATCGATATGCTGCATCGATCGTAGGCCTGGAAGGCGCAGATAGGCCAGCCTCTTCG
GCGCCAATGGTTTCCTCAGTGACGGGGGACGTGGTAGCACCTCACATCCTTGCCACTGCGGAATACTGGGTGCGC
AACCTCACCTCGCCTGTAGAATTCGCTTCCGCCTTCAACAAGGTCCTAGCATTTGCAACCCGGACATCTCGCAAA
AGGCTCGGCCGAGGCACGTTAGTCGATCCCCAGTTATCACATGTTCTCGAGATTGGGCCCCATAGCGCTCTCGAA
AGCTCTATACGCGAGAACTTGCTGAGCATGGAGGGCGTCACTAAGCCGGCGTACATGGCCTCTCTCGTCCGAGGC
CAAGATGGGTCAGTCACGTTGCTGCGCGCGGCTGCAGCGCTCTTTTGCGCCGGGCATCCTGTCGACCTCATGCGA
GCCAATGGCCTGCACGGAGACACTCGCAGGCAGGCACCTGCGGACATGCCACGTTACCCCTTCAACCACCAGCAA
AAGTACTGGGCGGAGAGCACTCTCAGCTCCAACTTTCGATTTCCCGGGGCGAGCCGGCATGACCTGTTTGGAGCC
CGCAGCCCGGATTGGAACCCGCAAGTGGCGCAGTGGCGCAACGTTCTGCGAGTGGCAGAGGTTCCGTGGCTGGAA
GACCACAGGATCGCCGGCGAAATTGTCTTCCCGGCTGCGGGATTCGTGGTGATGGCAATAGAGGCCCTGAGGCAA
CTCTTGGCTGATACTGAGCCAGTCCTTCGCGGTGTTATCATACACGATGTTGTCTTCGTGCACCCAATCCGCATT
CTACGGGGCACTCCGCACGTCGAGACACAGCTCACCCTGTCGAGCCAGCCGCACCACCTCACTCGTGACACTCCA
TCCTGGACAGAGTTTCGAATCTTCGTCCTGGACAACGGCAGCTATCTTGAGTGCAGCAGGGGTTTCATCAGACCC
ATCTTCGACGTTGAGGATCAAGATCGCATGGTGGCACTCGGCCCATGGGCCTCGGAGACCTGGCGCGACCGTGTC
TCCTCAGCTTGCCGGAGGTCAGTTGAAGACCCCTATGAGATGCCCAAGGAGAATGCAGTATCCTACGGGCCTGCG
TTCCGGTGCCTTGAAAATGTCTGTTTGGGCGATCAGGGCGAAGCTATGGCGAATATCAACACTGGAGCATGGAAG
TCGTCCGGGAGCGTCTCCGCCAGTCCTGACTATGGCGTGCATCCGACGGTCATGGACGGCCTGGCTCAACTGGTC
GTGCCAGCTGTCTCTCAACTTCGTGACAATGTCCAGACCATGGTCCCTGTTCGCGTGAACAGGATATGGTTGGAC
CTCAGCAGAGACGACTCGCGGCAGGGCAAAATCACTGTTCGAGGTGAGTGCCGACTGCGTGGCCATCGCGGAGCT
TACGCGAATCTCGTCGGGACCGGGCCTGCTTCTGGTAGCCCATTTATCTACCTCGACGGACTGGAGACCACCTTC
ATCGACAACGGACAGGAAAAATCGATCGGCCAAATAACGGTCGAGCCTCGGAAACTATGTACACATATAACCTGG
GAACCTGACATAGATTTCATGAGTCGCCAACAGTTACAAGTCCATTGCACGCGCAACCGCCCGCCCCAAAGAGAT
GGCGCGGTAGAGGCGTACAAGTCCCTGACACTTGCCATCATGGCATTCATTCATGAAGCCGTCTTTCGCATAGAT
AATCCAACGCCGTTGGTTCATCTGGATCGGCACCTCGAAGCGTTTGCCGGCTGGATGGGATTCCAACTGCAGCGA
CTTCATAGAGGAGACATGCTGGTCGATTATGACGCTGTGCTGACGCTTCTTCGAGATTCGGACGCGAGATGGCGG
CTTGTCTCTCAGGTTGAAGATTCTGGTATCGACGGCTTGTTCTTTATGCAGATTGGGCGCAACCTCGGCCAAATA
CTTTGCGGTAAAGTCGATCCCCTCGGCCTCATGTTCGAAAACGGCCTTGTCGACCGCTACTACGAAGAGATGCTC
GCAAACGAGCATCATGCTCATCCGGCCTCTGCCTACGTCGATCTCCTATGCTTCAAGAATCCGTCCATGAAGATC
ATTGAGGTCGGCGCGGGGACGGGGGGCCAGACCCTACGCTTGCTGGAGAAGATGAGCAGCGACGGCGTTCAGAAG
TGGGCTCGATACGACTACACGGACATCTCGCCTTCCTTCTTTGGTCAAGCACGACTCAAGCTCCAGGCATACGGC
AGTCGGTTGGACTTTCGGGTCTGCGACATTTCTCAAGATCCAGTTGGCCAATCCTTCGAGGCCGGGGCTTACGAC
CTCGTGGTCGCGTCGCACGTGCTCCACGCCACGAACCTTCTCGATGAGTCGCTTCGCAATGTACGGAAGCTACTC
AAGCCCGGAGGAAAACTGTTTTTGTTTGAGACGACATCCCCGGACGCCATCCTCGCCTTTGCTTTTGGGCTGCTC
AAGGGGTGGTGGAGCCCTCTTGATCACGAAATTCGATCTCCATTCAGCCCATGCTTGTCGGTCGAGCAGTGGGAC
GATCGGCTCAAACGTACAGGCTTCTCGGGCATAGACTTGGAGATCCCTGGCCAAGCAGAGCCTCAAACACGGTAC
AGCAGCTTCATCGTCTCCACTGCGCTCCATCCATCAACGATTGGCAGGGCCTCAACGCCTCAAGAATTCACCGTT
GTAGCAGACGGCTGCTCCCGAGCCCAGAAAGACATAGCCAATAGGCTCAAGACAGAACTGTCCTCTGACGGTCGA
TCTTGCGTTGTCATAGAGCTCTCCCATTACTCGTCGATCAAATCAGCTAGACTCGGCACTGTCATATTCCTACTC
GAGGTCGACTCGGTCTTTCTCGACGGCATGAGCGAGTTTGAATATCTGAGCATGAGATCCGTCATGGTTCGAGAA
ACAAGTACCCTTTGGGTGACCCGACCACCCGTACCGGGGGCAACAGAACCTCGTCATGGTCTTGCAGACGGACTG
GGGCGGGTGTTGATGTCGGAAGACGCGAGCCGCAAGTTCGTTACTCTGTCGTTAGACGGATGGGATCAAGATTCA
ACGTACGCTACCCTGTTAATATCCCAGTTGGCAGAACGCATTGCGGAGTCACCGGTTGAAGGCCTGGAGACCAAA
TACACGACCCTTGACGGGGTCTTACAGATTGGCCGCGTCCGGAAGGACGCCAGCATGGATAGCAGAATCGCCAAG
ACCCTAGAGCCTCGCGAGAAGCGCCAGACTCGAGTCGTCACGGATAGCAGCCGGCTGTCACTAGAAATAGGCATG
CCCGGCAACTTGGAGACGCTGGAATGGACAGAGGATGAGAGCGTATATGGCGAGCCGGCTCTGAACGACGACGAG
GTACTTGTCCGAGTTAGGGCAGTCGGACTGACAGACAGAGACTATCTCGTTGCGAGCGGTCAACTCGACGATCGA
GATCTGGGGATTGAATGTGCTGGCGAGGTGCAAGCTGCCGGCAAAAATTCCGGTTTCCGGTACGGAGACAGAGTA
TGCCTCATTGCCACTTCCACGTCGAGGTCCACCATTCGCGCCAAGGGCGAGACCATGGTTTCCATTCCCTCGCAC
TGGACATTCTCGGAGGCTTGTTCCCTGGCCAGTGCGGCCTGGACAGCCCACCATGCCTTGGTCAACATTGCGCGA
CTACGCGAGGGAGAGTCGGTTCTGATCCATCGGGCCGCGAAAAGCGAAGGCCAAATGGCGATCCAGCTGGCGAGG
GAGCTCGGCGCCCAGGTTTTTGTCAGTGTCGGCTCGGCCTCGGAACAAGAGTTACTGCGCGAAAGGCTGCAGATT
CCGGACTCGAATATCTTTCTCATATCACAGGGTCTATCGCTGCTAAGCGAGATCAGCCGGACCACGAAAACTTTA
GGGGTTGATGCCATCGTTGGCCCGCTTGCACTTGACGTCGACAAGATTGCCTTTGCGGAATGCCTGGCGCCGCTC
GGCCGGCTCATTGACACATGTACATGTCCTCGCCAAACCAGAGCGGATCAAGCACCCGTGCCACATCCCACAAAT
GTGCTTGTGGCATCTGTGGATATGATTGACCTGCTTCGGAAAAGGCCTGACTTGGCATACAGCTCGTTTCGCTCG
GCAATGGAAGCAGCCTTTGGGGCACCGCTGCAGGCACCGCATCCACTTGATCTGTTCACGGCGAATGAGGTTCAC
ACGGCCTTTCGTCAGGGCCATGACGACAGGACGGGCGTAAGCAAGAGAGTCATCGAGCTCAATCCGGATGTATCC
GTGACGGCGAACTTTCGGACGAGGCCTCGGTACAGCTTCGAAGCAGAGGCGACCTACGTCATTAGCGGAGGCTTA
GGTGGCCTCGGTAGGAGCTTTGCCAGATGGATGGTAAGCCGTGGAGCCAAGAACCTGATTTTGATGTCGCGCTCT
GGCGCCAGCACCGCCTCCGCGAGAGCACTTGTCCACGAGTTGATATCTCGAGATGTTCACGTGGAAACCCCGAAG
GTTGATGTGGGCAACCTGGCCGAGGTGCAAGAGATGGTTAGGGCGTTTGGTTCCACCATGCCACCTATTCGCGGC
TGCATACAGGCATCCGTCGTTTTGAGGGACAACCTGTTCCCCAACATGACCTACGAGGACTGGGTGATCAGCACC
AAGGCTAAGGTTGCGGGATCCTGGAATCTCCACGCTGCGCTGCCCCGAGACCTCGATTTCTTCATCCTTATCTCG
TCGCTGAACGGAATTATGGGAGGCCGTGGACAGGCGAACTACGGGGCGGGCAATGCCTTCGAGGATGCCCTCGCG
CAACATCGAGTTCTGTCAGGGCAGAAAGCCGTATCTATCGACCTAGGTCTCATGGTCGCCGAAGGAATCGTTGCC
GAGAACCCGCAGCTGCTGGCATCGATGCGCCGCATAGGCCATCTCATGGACATTCGCCGGGAAGAGCTTCTCGCC
CTGTTGGACCACTACTGCGATCCGGATCTGCCCGTCCTGGACCCGGCCGACGCGCAGATTCTTGTCGGGTTGGAG
CTACCGGACGCAGTTCTGGCCAAGGGCATCGACCTGCACCACTCGATCCGCCGTCCGCTCTTCCGCCACCTGTTC
CAGATGGGCCGAGGGCAGAGCGGCGGCGACGAGTCGGGCGCGAGCTCCGTGACCGCCGGCCTGGACCGGGCGTCG
ATGCTCGCCAGCGCGGACTCGCAGGCGGCCGCCGCCGCCCTCGTCGTCGCCTGGCTGGCCGGTAAGATCGGCCAG
ATCCTGGGCCTCGCCGAGGAGGACGTGGACGTGGCGAGGCCGGCACACACGTACAGCATCGACTCTCTGGTCGCC
ATCGACCTCAAGAACTGGTTTTCGAGGGAGATTGGGGCCGACATGGAGATATTCACCCTTCTCGGCAACGCGTCT
CTGGAGCAGCTTGCCGAGCAGGCGGCGGCAAAGAGCCGGTATCGGCAGCAGGCCGAGGCCTAG
Transcript >Hirsu2|9925
ATGGACAGCCTGCCCCAGGACGGCGGACCCGCCGCCCCTCTGGCCGTCATTGGCCTCGCCTTCGAGTTCCCGCAG
GGAGCCACCTCGGACGAGGCCTTCTGGCAGATGCTATACGAAGGGCGGTCGGCCAGCACCGACTTTCCCCGCAGC
CGCCTCGATATCGATGCCTTCTACCACCCGGACAAGGACCGGCCGAGCTCGATCCCGCTGCGGGGCGGCCACTTC
GTCGACGACGACCTCGCCGCCTTCGACGCCCCCTTCTTCTCCATCTCGGCCGCCGAGGCGGCCTGCATGGACCCG
CAGCACCGGCGGATGCTCGAGACGGCCTACCACGCCCTCGAGGATGCCGGCATCCCCCTCGGCGCCTTTGCCGGC
TCCGACACTGCCGTCTACACCGGCAGCTTCACCAACGACTACCTCGCCCTCCAGCAGCACGACCTCCAGGCCGAG
CGGCGCCACGGCGCCATGGGCGTCGCCGCCTCCATGATGGCCAACCGCCTCAGCTGGTTCTTCGATCTCAAGGGC
ACCTCCTTCAACGTCGACTCGGCCTGCTCCAGCAGCCTGCTCGCTCTGCACCTTGCCTGCCAAGACCTGCGAGCC
GGCAACTCGTCCATGGCGCTCGTCGGCGGCGCGAACCTGGTCTTCCACCCCGGCTTCATGAAGCTCATGTCCGAC
GCCAACTTCCTCTCCGTCGACGGCCGTTGCTGGAGCTTCGACGACCGCGCCAACGGCTATGCCCGCGGCGAGGGC
ATCGCCGTCGTTCTTATCAAGCCCCTGGCCCACGCCCTGCGTGACGGCGACACCGTCCGAGCCGTCATTCGAAAC
ACCGGCTCAAACCAGGACGGTCGCACCCCCGGCATCACACAGCCCAACCGCCAGTCGCAGATCGACCTCATCCGA
AAGACCTACCAGCAGGCTGGCGTCGACATGGGCCCGACGCGCTTCTTCGAGGCCCATGCCACGGCCACTCCCGTT
GGCGACCCCATCGAGGCCGGCGCCATTGGTGCCTCGTTCCGGCAGCATCGCAGCTCTTCCAGTCCCATGCACGTC
GGTGCCGTGAAGGCCAACATAGGCCACCTCGAAAGCTGCAGTGGCCTCGCCGGTCTCATCAAAACCATACTTGTT
CTGGAGAGGGGGGTTATCCCCCCGATAGCCGGGCTTCAAATCCTGAATCGGCAAATCGATGCCGAGAATCTGCAT
CTTCATTTCCCGACTAAACCTGTCCCTTGGCCCCCAGGTGACGTTCGCCGGGCGTGTATTAATTCCTTTGGTTTT
GGTGGCACCAACGTGGTGGCTATCCTTGACGACGCTTCCCATCATTCAAGAGACAAAAGCCTCCACGGCTTTCAT
CGTACTGAGGGAAAGTTTTCCGCCAGCCAAAACGGACATGCTGAGCCCCGAACCCCATCTTTGATATCAGAATCA
ACGCTCAATGGCTTTTACCCGTCGGACGAGCCAGCCACGCGCCCGTCACTTCTTATTTGGTCTGCCCCTGATCGG
GCCGGAGCGGAGAGGCTGTCTCACGCCTATGATGACTACATTCGCCGCATAGATTCGCTCAAGCTGAGAAACTTG
GCATATGCCCTGGCCGTCAAGCGAACTCTGTTTCCATGGAGAAGCTTTACCGTTGCCTACCCAAGTAGCAGCAAT
GGCGACCCGGGGCCCCCCCTTTTCGCGAAGCCGACCAAAGCAACGAGCAGAACAGGCGTCGCGTTTGTATTCACC
GGCCAGGGAGCTCAGTATCTCGGTATGGGACGTCGTCTGCTCAGTTTTCCGGTGTTTCGGGACAGCCTCGGACGC
TGCGAGGATTGTCTTCGACTGTTTGGTTGTCCATGGTCGCTCCTGGACGTCGTCAACGGCGCAAATGATCAGATC
AAAATGGACCAAGCCGACATCAGCCAACCTTCTACGACGTGCCTTCAGATTGCCCTCGTAGACATGTTGCGTGAC
CTTGGAATCTCGCCATCTATGGTGACCGGACATTCATCCGGCGAGATTGCGGCCGCATATTGCACGGGTGCCCTA
TCACGTTCCTCTGCCGTCAAGATAGCCTACTACCGTGGACTCCTCTGCTCTCGGTTAGCAGCCGAAGTCGACGAC
TTGGCCATGCTGGCCGTGGGGCTTTCCAAGGATCAGATACTCCCCTACCTCAAGTGCCTGCACAACGTCGACAAC
GCAGTCGACGTGGAAATAGGCTGCGTAAACAGCCCAAAGAACATCACGTTGACTGGAAGTGCCTCGCAACTTGCC
GCACTGGAGGACTGTCTGAAGCGCGAAAACATTTTTGCTCGGCGACTCCGCGTGCCGCTGGCCTACCACTCACGC
TTCATGACAGCCATCGCTGATCGATATGCTGCATCGATCGTAGGCCTGGAAGGCGCAGATAGGCCAGCCTCTTCG
GCGCCAATGGTTTCCTCAGTGACGGGGGACGTGGTAGCACCTCACATCCTTGCCACTGCGGAATACTGGGTGCGC
AACCTCACCTCGCCTGTAGAATTCGCTTCCGCCTTCAACAAGGTCCTAGCATTTGCAACCCGGACATCTCGCAAA
AGGCTCGGCCGAGGCACGTTAGTCGATCCCCAGTTATCACATGTTCTCGAGATTGGGCCCCATAGCGCTCTCGAA
AGCTCTATACGCGAGAACTTGCTGAGCATGGAGGGCGTCACTAAGCCGGCGTACATGGCCTCTCTCGTCCGAGGC
CAAGATGGGTCAGTCACGTTGCTGCGCGCGGCTGCAGCGCTCTTTTGCGCCGGGCATCCTGTCGACCTCATGCGA
GCCAATGGCCTGCACGGAGACACTCGCAGGCAGGCACCTGCGGACATGCCACGTTACCCCTTCAACCACCAGCAA
AAGTACTGGGCGGAGAGCACTCTCAGCTCCAACTTTCGATTTCCCGGGGCGAGCCGGCATGACCTGTTTGGAGCC
CGCAGCCCGGATTGGAACCCGCAAGTGGCGCAGTGGCGCAACGTTCTGCGAGTGGCAGAGGTTCCGTGGCTGGAA
GACCACAGGATCGCCGGCGAAATTGTCTTCCCGGCTGCGGGATTCGTGGTGATGGCAATAGAGGCCCTGAGGCAA
CTCTTGGCTGATACTGAGCCAGTCCTTCGCGGTGTTATCATACACGATGTTGTCTTCGTGCACCCAATCCGCATT
CTACGGGGCACTCCGCACGTCGAGACACAGCTCACCCTGTCGAGCCAGCCGCACCACCTCACTCGTGACACTCCA
TCCTGGACAGAGTTTCGAATCTTCGTCCTGGACAACGGCAGCTATCTTGAGTGCAGCAGGGGTTTCATCAGACCC
ATCTTCGACGTTGAGGATCAAGATCGCATGGTGGCACTCGGCCCATGGGCCTCGGAGACCTGGCGCGACCGTGTC
TCCTCAGCTTGCCGGAGGTCAGTTGAAGACCCCTATGAGATGCCCAAGGAGAATGCAGTATCCTACGGGCCTGCG
TTCCGGTGCCTTGAAAATGTCTGTTTGGGCGATCAGGGCGAAGCTATGGCGAATATCAACACTGGAGCATGGAAG
TCGTCCGGGAGCGTCTCCGCCAGTCCTGACTATGGCGTGCATCCGACGGTCATGGACGGCCTGGCTCAACTGGTC
GTGCCAGCTGTCTCTCAACTTCGTGACAATGTCCAGACCATGGTCCCTGTTCGCGTGAACAGGATATGGTTGGAC
CTCAGCAGAGACGACTCGCGGCAGGGCAAAATCACTGTTCGAGGTGAGTGCCGACTGCGTGGCCATCGCGGAGCT
TACGCGAATCTCGTCGGGACCGGGCCTGCTTCTGGTAGCCCATTTATCTACCTCGACGGACTGGAGACCACCTTC
ATCGACAACGGACAGGAAAAATCGATCGGCCAAATAACGGTCGAGCCTCGGAAACTATGTACACATATAACCTGG
GAACCTGACATAGATTTCATGAGTCGCCAACAGTTACAAGTCCATTGCACGCGCAACCGCCCGCCCCAAAGAGAT
GGCGCGGTAGAGGCGTACAAGTCCCTGACACTTGCCATCATGGCATTCATTCATGAAGCCGTCTTTCGCATAGAT
AATCCAACGCCGTTGGTTCATCTGGATCGGCACCTCGAAGCGTTTGCCGGCTGGATGGGATTCCAACTGCAGCGA
CTTCATAGAGGAGACATGCTGGTCGATTATGACGCTGTGCTGACGCTTCTTCGAGATTCGGACGCGAGATGGCGG
CTTGTCTCTCAGGTTGAAGATTCTGGTATCGACGGCTTGTTCTTTATGCAGATTGGGCGCAACCTCGGCCAAATA
CTTTGCGGTAAAGTCGATCCCCTCGGCCTCATGTTCGAAAACGGCCTTGTCGACCGCTACTACGAAGAGATGCTC
GCAAACGAGCATCATGCTCATCCGGCCTCTGCCTACGTCGATCTCCTATGCTTCAAGAATCCGTCCATGAAGATC
ATTGAGGTCGGCGCGGGGACGGGGGGCCAGACCCTACGCTTGCTGGAGAAGATGAGCAGCGACGGCGTTCAGAAG
TGGGCTCGATACGACTACACGGACATCTCGCCTTCCTTCTTTGGTCAAGCACGACTCAAGCTCCAGGCATACGGC
AGTCGGTTGGACTTTCGGGTCTGCGACATTTCTCAAGATCCAGTTGGCCAATCCTTCGAGGCCGGGGCTTACGAC
CTCGTGGTCGCGTCGCACGTGCTCCACGCCACGAACCTTCTCGATGAGTCGCTTCGCAATGTACGGAAGCTACTC
AAGCCCGGAGGAAAACTGTTTTTGTTTGAGACGACATCCCCGGACGCCATCCTCGCCTTTGCTTTTGGGCTGCTC
AAGGGGTGGTGGAGCCCTCTTGATCACGAAATTCGATCTCCATTCAGCCCATGCTTGTCGGTCGAGCAGTGGGAC
GATCGGCTCAAACGTACAGGCTTCTCGGGCATAGACTTGGAGATCCCTGGCCAAGCAGAGCCTCAAACACGGTAC
AGCAGCTTCATCGTCTCCACTGCGCTCCATCCATCAACGATTGGCAGGGCCTCAACGCCTCAAGAATTCACCGTT
GTAGCAGACGGCTGCTCCCGAGCCCAGAAAGACATAGCCAATAGGCTCAAGACAGAACTGTCCTCTGACGGTCGA
TCTTGCGTTGTCATAGAGCTCTCCCATTACTCGTCGATCAAATCAGCTAGACTCGGCACTGTCATATTCCTACTC
GAGGTCGACTCGGTCTTTCTCGACGGCATGAGCGAGTTTGAATATCTGAGCATGAGATCCGTCATGGTTCGAGAA
ACAAGTACCCTTTGGGTGACCCGACCACCCGTACCGGGGGCAACAGAACCTCGTCATGGTCTTGCAGACGGACTG
GGGCGGGTGTTGATGTCGGAAGACGCGAGCCGCAAGTTCGTTACTCTGTCGTTAGACGGATGGGATCAAGATTCA
ACGTACGCTACCCTGTTAATATCCCAGTTGGCAGAACGCATTGCGGAGTCACCGGTTGAAGGCCTGGAGACCAAA
TACACGACCCTTGACGGGGTCTTACAGATTGGCCGCGTCCGGAAGGACGCCAGCATGGATAGCAGAATCGCCAAG
ACCCTAGAGCCTCGCGAGAAGCGCCAGACTCGAGTCGTCACGGATAGCAGCCGGCTGTCACTAGAAATAGGCATG
CCCGGCAACTTGGAGACGCTGGAATGGACAGAGGATGAGAGCGTATATGGCGAGCCGGCTCTGAACGACGACGAG
GTACTTGTCCGAGTTAGGGCAGTCGGACTGACAGACAGAGACTATCTCGTTGCGAGCGGTCAACTCGACGATCGA
GATCTGGGGATTGAATGTGCTGGCGAGGTGCAAGCTGCCGGCAAAAATTCCGGTTTCCGGTACGGAGACAGAGTA
TGCCTCATTGCCACTTCCACGTCGAGGTCCACCATTCGCGCCAAGGGCGAGACCATGGTTTCCATTCCCTCGCAC
TGGACATTCTCGGAGGCTTGTTCCCTGGCCAGTGCGGCCTGGACAGCCCACCATGCCTTGGTCAACATTGCGCGA
CTACGCGAGGGAGAGTCGGTTCTGATCCATCGGGCCGCGAAAAGCGAAGGCCAAATGGCGATCCAGCTGGCGAGG
GAGCTCGGCGCCCAGGTTTTTGTCAGTGTCGGCTCGGCCTCGGAACAAGAGTTACTGCGCGAAAGGCTGCAGATT
CCGGACTCGAATATCTTTCTCATATCACAGGGTCTATCGCTGCTAAGCGAGATCAGCCGGACCACGAAAACTTTA
GGGGTTGATGCCATCGTTGGCCCGCTTGCACTTGACGTCGACAAGATTGCCTTTGCGGAATGCCTGGCGCCGCTC
GGCCGGCTCATTGACACATGTACATGTCCTCGCCAAACCAGAGCGGATCAAGCACCCGTGCCACATCCCACAAAT
GTGCTTGTGGCATCTGTGGATATGATTGACCTGCTTCGGAAAAGGCCTGACTTGGCATACAGCTCGTTTCGCTCG
GCAATGGAAGCAGCCTTTGGGGCACCGCTGCAGGCACCGCATCCACTTGATCTGTTCACGGCGAATGAGGTTCAC
ACGGCCTTTCGTCAGGGCCATGACGACAGGACGGGCGTAAGCAAGAGAGTCATCGAGCTCAATCCGGATGTATCC
GTGACGGCGAACTTTCGGACGAGGCCTCGGTACAGCTTCGAAGCAGAGGCGACCTACGTCATTAGCGGAGGCTTA
GGTGGCCTCGGTAGGAGCTTTGCCAGATGGATGGTAAGCCGTGGAGCCAAGAACCTGATTTTGATGTCGCGCTCT
GGCGCCAGCACCGCCTCCGCGAGAGCACTTGTCCACGAGTTGATATCTCGAGATGTTCACGTGGAAACCCCGAAG
GTTGATGTGGGCAACCTGGCCGAGGTGCAAGAGATGGTTAGGGCGTTTGGTTCCACCATGCCACCTATTCGCGGC
TGCATACAGGCATCCGTCGTTTTGAGGGACAACCTGTTCCCCAACATGACCTACGAGGACTGGGTGATCAGCACC
AAGGCTAAGGTTGCGGGATCCTGGAATCTCCACGCTGCGCTGCCCCGAGACCTCGATTTCTTCATCCTTATCTCG
TCGCTGAACGGAATTATGGGAGGCCGTGGACAGGCGAACTACGGGGCGGGCAATGCCTTCGAGGATGCCCTCGCG
CAACATCGAGTTCTGTCAGGGCAGAAAGCCGTATCTATCGACCTAGGTCTCATGGTCGCCGAAGGAATCGTTGCC
GAGAACCCGCAGCTGCTGGCATCGATGCGCCGCATAGGCCATCTCATGGACATTCGCCGGGAAGAGCTTCTCGCC
CTGTTGGACCACTACTGCGATCCGGATCTGCCCGTCCTGGACCCGGCCGACGCGCAGATTCTTGTCGGGTTGGAG
CTACCGGACGCAGTTCTGGCCAAGGGCATCGACCTGCACCACTCGATCCGCCGTCCGCTCTTCCGCCACCTGTTC
CAGATGGGCCGAGGGCAGAGCGGCGGCGACGAGTCGGGCGCGAGCTCCGTGACCGCCGGCCTGGACCGGGCGTCG
ATGCTCGCCAGCGCGGACTCGCAGGCGGCCGCCGCCGCCCTCGTCGTCGCCTGGCTGGCCGGTAAGATCGGCCAG
ATCCTGGGCCTCGCCGAGGAGGACGTGGACGTGGCGAGGCCGGCACACACGTACAGCATCGACTCTCTGGTCGCC
ATCGACCTCAAGAACTGGTTTTCGAGGGAGATTGGGGCCGACATGGAGATATTCACCCTTCTCGGCAACGCGTCT
CTGGAGCAGCTTGCCGAGCAGGCGGCGGCAAAGAGCCGGTATCGGCAGCAGGCCGAGGCCTAG
Gene >Hirsu2|9925
ATGGACAGCCTGCCCCAGGACGGCGGACCCGCCGCCCCTCTGGCCGTCATTGGCCTCGCCTTCGAGTTCCCGCAG
GGAGCCACCTCGGACGAGGCCTTCTGGCAGATGCTATACGAAGGGCGGTCGGCCAGCACCGACTTTCCCCGCAGC
CGCCTCGATATCGATGCCTTCTACCACCCGGACAAGGACCGGCCGAGCTCGGTGAGCAGCGCAGCCGGCGCGGGC
GGCAGATAGCAGCTCGTGGACGCTGACCGCGGCACCAGATCCCGCTGCGGGGCGGCCACTTCGTCGACGACGACC
TCGCCGCCTTCGACGCCCCCTTCTTCTCCATCTCGGCCGCCGAGGCGGCCTGCATGGACCCGCAGCACCGGCGGA
TGCTCGAGACGGCCTACCACGCCCTCGAGGATGCCGGCATCCCCCTCGGCGCCTTTGCCGGCTCCGACACTGCCG
TCTACACCGGCAGCTTCACCAACGACTACCTCGCCCTCCAGCAGCACGACCTCCAGGCCGAGCGGCGCCACGGCG
CCATGGGCGTCGCCGCCTCCATGATGGCCAACCGCCTCAGCTGGTTCTTCGATCTCAAGGGCACCTCCTTCAACG
TCGACTCGGCCTGCTCCAGCAGCCTGCTCGCTCTGCACCTTGCCTGCCAAGACCTGCGAGCCGGCAACTCGTCCA
TGGTAGGCCTTTTGCGGTCGCCTGCCTGCTCGCGCCGCCCGCCCTGCTAAGTCCCGTCGCATCCTCCCAGGCGCT
CGTCGGCGGCGCGAACCTGGTCTTCCACCCCGGCTTCATGAAGCTCATGTCCGACGCCAACTTCCTCTCCGTCGA
CGGCCGTTGCTGGAGCTTCGACGACCGCGCCAACGGCTATGCCCGCGGCGAGGGCATCGCCGTCGTTCTTATCAA
GCCCCTGGCCCACGCCCTGCGTGACGGCGACACCGTCCGAGCCGTCATTCGAAACACCGGCTCAAACCAGGACGG
TCGCACCCCCGGCATCACACAGCCCAACCGCCAGTCGCAGATCGACCTCATCCGAAAGACCTACCAGCAGGCTGG
CGTCGACATGGGCCCGACGCGCTTCTTCGAGGCCCATGCCACGGCCACTCCCGTTGGCGACCCCATCGAGGCCGG
CGCCATTGGTGCCTCGTTCCGGCAGCATCGCAGCTCTTCCAGTCCCATGCACGTCGGTGCCGTGAAGGCCAACAT
AGGCCACCTCGAAAGCTGCAGTGGCCTCGCCGGTCTCATCAAAACCATACTTGTTCTGGAGAGGGGGGTTATCCC
CCCGATAGCCGGGCTTCAAATCCTGAATCGGCAAATCGATGCCGAGAATCTGCATCTTCATGTGAGCTTGCCATA
CGCCAGCCCTTCTCTGGTTGGATGTTAATCTTGTCAACCAGTTCCCGACTAAACCTGTCCCTTGGCCCCCAGGTG
ACGTTCGCCGGGCGTGTGTAAGTACACGTGTCCCGCATCGCTCCCAGATGAGATCCTCAATCTCACATGCGTCCC
GCAGATTAATTCCTTTGGTTTTGGTGGCACCAACGTGGTGGCTATCCTTGACGACGCTTCCCATCATTCAAGAGA
CAAAAGCCTCCACGGCTTTCATCGTACTGAGGGAAAGTTTTCCGCCAGCCAAAACGGACATGCTGAGCCCCGAAC
CCCATCTTTGATATCAGAATCAACGCTCAATGGCTTTTACCCGTCGGACGAGCCAGCCACGCGCCCGTCACTTCT
TATTTGGTCTGCCCCTGATCGGGCCGGAGCGGAGAGGCTGTCTCACGCCTATGATGACTACATTCGCCGCATAGA
TTCGCTCAAGCTGAGAAACTTGGCATATGCCCTGGCCGTCAAGCGAACTCTGTTTCCATGGAGAAGCTTTACCGT
TGCCTACCCAAGTAGCAGCAATGGCGACCCGGGGCCCCCCCTTTTCGCGAAGCCGACCAAAGCAACGAGCAGAAC
AGGCGTCGCGTTTGTATTCACCGGCCAGGGAGCTCAGTATCTCGGTATGGGACGTCGTCTGCTCAGTTTTCCGGT
GTTTCGGGACAGCCTCGGACGCTGCGAGGATTGTCTTCGACTGTTTGGTTGTCCATGGTCGCTCCTGGACGTCGT
CAACGGCGCAAATGATCAGATCAAAATGGACCAAGCCGACATCAGCCAACCTTCTACGACGTGCCTTCAGATTGC
CCTCGTAGACATGTTGCGTGACCTTGGAATCTCGCCATCTATGGTGACCGGACATTCATCCGGCGAGATTGCGGC
CGCATATTGCACGGGTGCCCTATCACGTTCCTCTGCCGTCAAGATAGCCTACTACCGTGGACTCCTCTGCTCTCG
GTTAGCAGCCGAAGTCGACGACTTGGCCATGCTGGCCGTGGGGCTTTCCAAGGATCAGATACTCCCCTACCTCAA
GTGCCTGCACAACGTCGACAACGCAGTCGACGTGGAAATAGGCTGCGTAAACAGCCCAAAGAACATCACGTTGAC
TGGAAGTGCCTCGCAACTTGCCGCACTGGAGGACTGTCTGAAGCGCGAAAACATTTTTGCTCGGCGACTCCGCGT
GCCGCTGGCCTACCACTCACGCTTCATGACAGCCATCGCTGATCGATATGCTGCATCGATCGTAGGCCTGGAAGG
CGCAGATAGGCCAGCCTCTTCGGCGCCAATGGTTTCCTCAGTGACGGGGGACGTGGTAGCACCTCACATCCTTGC
CACTGCGGAATACTGGGTGCGCAACCTCACCTCGCCTGTAGAATTCGCTTCCGCCTTCAACAAGGTCCTAGCATT
TGCAACCCGGACATCTCGCAAAAGGCTCGGCCGAGGCACGTTAGTCGATCCCCAGTTATCACATGTTCTCGAGAT
TGGGCCCCATAGCGCTCTCGAAAGCTCTATACGCGAGAACTTGCTGAGCATGGAGGGCGTCACTAAGCCGGCGTA
CATGGCCTCTCTCGTCCGAGGCCAAGATGGGTCAGTCACGTTGCTGCGCGCGGCTGCAGCGCTCTTTTGCGCCGG
GCATCCTGTCGACCTCATGCGAGCCAATGGCCTGCACGGAGACACTCGCAGGCAGGCACCTGCGGACATGCCACG
TTACCCCTTCAACCACCAGCAAAAGTACTGGGCGGAGAGCACTCTCAGCTCCAACTTTCGATTTCCCGGGGCGAG
CCGGCATGACCTGTTTGGAGCCCGCAGCCCGGATTGGAACCCGCAAGTGGCGCAGTGGCGCAACGTTCTGCGAGT
GGCAGAGGTTCCGTGGCTGGAAGACCACAGGATCGCCGGCGAAATTGTCTTCCCGGCTGCGGGATTCGTGGTGAT
GGCAATAGAGGCCCTGAGGCAACTCTTGGCTGATACTGAGCCAGTCCTTCGCGGTGTTATCATACACGATGTTGT
CTTCGTGCACCCAATCCGCATTCTACGGGGCACTCCGCACGTCGAGACACAGCTCACCCTGTCGAGCCAGCCGCA
CCACCTCACTCGTGACACTCCATCCTGGACAGAGTTTCGAATCTTCGTCCTGGACAACGGCAGCTATCTTGAGTG
CAGCAGGGGTTTCATCAGACCCATCTTCGACGTTGAGGATCAAGATCGCATGGTGGCACTCGGCCCATGGGCCTC
GGAGACCTGGCGCGACCGTGTCTCCTCAGCTTGCCGGAGGTCAGTTGAAGACCCCTATGAGATGCCCAAGGAGAA
TGCAGTATCCTACGGGCCTGCGTTCCGGTGCCTTGAAAATGTCTGTTTGGGCGATCAGGGCGAAGCTATGGCGAA
TATCAACACTGGAGCATGGAAGTCGTCCGGGAGCGTCTCCGCCAGTCCTGACTATGGCGTGCATCCGACGGTCAT
GGACGGCCTGGCTCAACTGGTCGTGCCAGCTGTCTCTCAACTTCGTGACAATGTCCAGACCATGGTCCCTGTTCG
CGTGAACAGGATATGGTTGGACCTCAGCAGAGACGACTCGCGGCAGGGCAAAATCACTGTTCGAGGTGAGTGCCG
ACTGCGTGGCCATCGCGGAGCTTACGCGAATCTCGTCGGGACCGGGCCTGCTTCTGGTAGCCCATTTATCTACCT
CGACGGACTGGAGACCACCTTCATCGACAACGGACAGGAAAAATCGATCGGCCAAATAACGGTCGAGCCTCGGAA
ACTATGTACACATATAACCTGGGAACCTGACATAGATTTCATGAGTCGCCAACAGTTACAAGTCCATTGCACGCG
CAACCGCCCGCCCCAAAGAGATGGCGCGGTAGAGGCGTACAAGTCCCTGACACTTGCCATCATGGCATTCATTCA
TGAAGCCGTCTTTCGCATAGATAATCCAACGCCGTTGGTTCATCTGGATCGGCACCTCGAAGCGTTTGCCGGCTG
GATGGGATTCCAACTGCAGCGACTTCATAGAGGAGACATGCTGGTCGATTATGACGCTGTGCTGACGCTTCTTCG
AGATTCGGACGCGAGATGGCGGCTTGTCTCTCAGGTTGAAGATTCTGGTATCGACGGCTTGTTCTTTATGCAGAT
TGGGCGCAACCTCGGCCAAATACTTTGCGGTAAAGTCGATCCCCTCGGCCTCATGTTCGAAAACGGCCTTGTCGA
CCGCTACTACGAAGAGATGCTCGCAAACGAGCATCATGCTCATCCGGCCTCTGCCTACGTCGATCTCCTATGCTT
CAAGAATCCGTCCATGAAGATCATTGAGGTCGGCGCGGGGACGGGGGGCCAGACCCTACGCTTGCTGGAGAAGAT
GAGCAGCGACGGCGTTCAGAAGTGGGCTCGATACGACTACACGGACATCTCGCCTTCCTTCTTTGGTCAAGCACG
ACTCAAGCTCCAGGCATACGGCAGTCGGTTGGACTTTCGGGTCTGCGACATTTCTCAAGATCCAGTTGGCCAATC
CTTCGAGGCCGGGGCTTACGACCTCGTGGTCGCGTCGCACGTGCTCCACGCCACGAACCTTCTCGATGAGTCGCT
TCGCAATGTACGGAAGCTACTCAAGCCCGGAGGAAAACTGTTTTTGTTTGAGACGACATCCCCGGACGCCATCCT
CGCCTTTGCTTTTGGGCTGCTCAAGGGGTGGTGGAGCCCTCTTGATCACGAAATTCGATCTCCATTCAGCCCATG
CTTGTCGGTCGAGCAGTGGGACGATCGGCTCAAACGTACAGGCTTCTCGGGCATAGACTTGGAGATCCCTGGCCA
AGCAGAGCCTCAAACACGGTACAGCAGCTTCATCGTCTCCACTGCGCTCCATCCATCAACGATTGGCAGGGCCTC
AACGCCTCAAGAATTCACCGTTGTAGCAGACGGCTGCTCCCGAGCCCAGAAAGACATAGCCAATAGGCTCAAGAC
AGAACTGTCCTCTGACGGTCGATCTTGCGTTGTCATAGAGCTCTCCCATTACTCGTCGATCAAATCAGCTAGACT
CGGCACTGTCATATTCCTACTCGAGGTCGACTCGGTCTTTCTCGACGGCATGAGCGAGTTTGAATATCTGAGCAT
GAGATCCGTCATGGTTCGAGAAACAAGTACCCTTTGGGTGACCCGACCACCCGTACCGGGGGCAACAGAACCTCG
TCATGGTCTTGCAGACGGACTGGGGCGGGTGTTGATGTCGGAAGACGCGAGCCGCAAGTTCGTTACTCTGTCGTT
AGACGGATGGGATCAAGATTCAACGTACGCTACCCTGTTAATATCCCAGTTGGCAGAACGCATTGCGGAGTCACC
GGTTGAAGGCCTGGAGACCAAATACACGACCCTTGACGGGGTCTTACAGATTGGCCGCGTCCGGAAGGACGCCAG
CATGGATAGCAGAATCGCCAAGACCCTAGAGCCTCGCGAGAAGCGCCAGACTCGAGTCGTCACGGATAGCAGCCG
GCTGTCACTAGAAATAGGCATGCCCGGCAACTTGGAGACGCTGGAATGGACAGAGGATGAGAGCGTATATGGCGA
GCCGGCTCTGAACGACGACGAGGTACTTGTCCGAGTTAGGGCAGTCGGACTGACAGACAGAGACTATCTCGTTGC
GAGCGGTCAACTCGACGATCGAGATCTGGGGATTGAATGTGCTGGCGAGGTGCAAGCTGCCGGCAAAAATTCCGG
TTTCCGGTACGGAGACAGAGTATGCCTCATTGCCACTTCCACGTCGAGGTCCACCATTCGCGCCAAGGGCGAGAC
CATGGTTTCCATTCCCTCGCACTGGACATTCTCGGAGGCTTGTTCCCTGGCCAGTGCGGCCTGGACAGCCCACCA
TGCCTTGGTCAACATTGCGCGACTACGCGAGGGAGAGTCGGTTCTGATCCATCGGGCCGCGAAAAGCGAAGGCCA
AATGGCGATCCAGCTGGCGAGGGAGCTCGGCGCCCAGGTTTTTGTCAGTGTCGGCTCGGCCTCGGAACAAGAGTT
ACTGCGCGAAAGGCTGCAGATTCCGGACTCGAATATCTTTCTCATATCACAGGGTCTATCGCTGCTAAGCGAGAT
CAGCCGGACCACGAAAACTTTAGGGGTTGATGCCATCGTTGGCCCGCTTGCACTTGACGTCGACAAGATTGCCTT
TGCGGAATGCCTGGCGCCGCTCGGCCGGCTCATTGACACATGTACATGTCCTCGCCAAACCAGAGCGGATCAAGC
ACCCGTGCCACATCCCACAAATGTGCTTGTGGCATCTGTGGATATGATTGACCTGCTTCGGAAAAGGCCTGACTT
GGCATACAGCTCGTTTCGCTCGGCAATGGAAGCAGCCTTTGGGGCACCGCTGCAGGCACCGCATCCACTTGATCT
GTTCACGGCGAATGAGGTTCACACGGCCTTTCGTCAGGGCCATGACGACAGGACGGGCGTAAGCAAGAGAGTCAT
CGAGCTCAATCCGGATGTATCCGTGACGGTATGTGCGTGTTGAAATCTTGTGATATTCAGCATTAACACACAGAA
ACAGGCGAACTTTCGGACGAGGCCTCGGTACAGCTTCGAAGCAGAGGCGACCTACGTCATTAGCGGAGGCTTAGG
TGGCCTCGGTAGGAGCTTTGCCAGATGGATGGTAAGCCGTGGAGCCAAGAACCTGATTTTGATGTCGCGCTCTGG
CGCCAGCACCGCCTCCGCGAGAGCACTTGTCCACGAGTTGATATCTCGAGATGTTCACGTGGAAACCCCGAAGGT
TGATGTGGGCAACCTGGCCGAGGTGCAAGAGATGGTTAGGGCGTTTGGTTCCACCATGCCACCTATTCGCGGCTG
CATACAGGCATCCGTCGTTTTGAGGGTTTGTCTCCCTGCAATTGCTTCGCAGGCTCGATATATCTAACGGCGCAA
AGGACAACCTGTTCCCCAACATGACCTACGAGGACTGGGTGATCAGCACCAAGGCTAAGGTTGCGGGATCCTGGA
ATCTCCACGCTGCGCTGCCCCGAGACCTCGATTTCTTCATCCTTATCTCGTCGCTGAACGGAATTATGGGAGGCC
GTGGACAGGCGAACTACGGGGCGGGCAATGCCTTCGAGGATGCCCTCGCGCAACATCGAGTTCTGTCAGGGCAGA
AAGCCGTATCTATCGACCTAGGTCTCATGGTCGCCGAAGGAATCGTTGCCGAGAACCCGCAGCTGCTGGCATCGA
TGCGCCGCATAGGCCATCTCATGGACATTCGCCGGGAAGAGCTTCTCGCCCTGTTGGACCACTACTGCGATCCGG
ATCTGCCCGTCCTGGACCCGGCCGACGCGCAGATTCTTGTCGGGTTGGAGCTACCGGACGCAGTTCTGGCCAAGG
GCATCGACCTGCACCACTCGATCCGCCGTCCGCTCTTCCGCCACCTGTTCCAGATGGGCCGAGGGCAGAGCGGCG
GCGACGAGTCGGGCGCGAGCTCCGTGACCGCCGGCCTGGACCGGGCGTCGATGCTCGCCAGCGCGGACTCGCAGG
CGGCCGCCGCCGCCCTCGTCGTCGCCTGGCTGGCCGGTAAGATCGGCCAGATCCTGGGCCTCGCCGAGGAGGACG
TGGACGTGGCGAGGCCGGCACACACGTACAGCATCGACTCTCTGGTCGCCATCGACCTCAAGAACTGGTTTTCGA
GGGAGATTGGGGCCGACATGGAGATATTCACCCTTCTCGGCAACGCGTCTCTGGAGCAGCTTGCCGAGCAGGCGG
CGGCAAAGAGCCGGTATCGGCAGCAGGCCGAGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail