Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|992
Gene name
LocationContig_1204:4130..4511
Strand+
Gene length (bp)381
Transcript length (bp)381
Coding sequence length (bp)381
Protein length (aa) 127

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 4 122 6.0E-24
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 4 125 4.0E-21
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 7 124 1.0E-18
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 4 125 4.0E-16
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 1 123 4.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 4 122 6.0E-24
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 4 125 4.0E-21
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 7 124 1.0E-18
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 4 125 4.0E-16
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 1 123 4.0E-16
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 4 125 2.0E-15
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 4 125 3.0E-15
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 4 125 5.0E-15
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 7 123 9.0E-15
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 1 123 5.0E-14
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 3 126 2.0E-13
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 1 123 3.0E-13
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 1 125 4.0E-13
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 3 126 1.0E-12
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 1 126 3.0E-12
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 1 123 2.0E-11
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 4 125 2.0E-11
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 4 125 7.0E-11
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 4 125 8.0E-11
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 4 124 1.0E-08
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 4 123 3.0E-08
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 4 122 1.0E-07
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 8 126 4.0E-07
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 4 103 6.0E-06
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 4 103 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 57 79 22
3 94 116 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|992
MVPGAVLVPVGLLVYSWTAESRIHWVGPNVGAAIYAAGTIASFQCVQGYTVGSYSRYAAGAVGVITVLRSLAGFG
FPLFAPYMYESLGYGNGGTVLAACAVAIGWPSPALLWLYGAKLRAKSKFSA*
Coding >Hirsu2|992
ATGGTCCCTGGCGCCGTCCTCGTCCCCGTCGGCCTGCTTGTCTACTCGTGGACGGCCGAGTCACGGATACACTGG
GTCGGGCCCAACGTCGGCGCCGCCATCTACGCCGCCGGCACCATCGCTAGCTTCCAGTGTGTCCAGGGCTATACG
GTCGGCTCCTACAGCCGCTACGCCGCCGGCGCCGTCGGCGTCATCACCGTCCTTCGCAGCCTGGCTGGCTTCGGC
TTTCCGCTCTTCGCCCCCTATATGTACGAAAGCCTGGGCTACGGCAACGGAGGGACCGTCCTAGCGGCCTGTGCC
GTCGCTATCGGCTGGCCGAGCCCCGCGCTGCTTTGGTTGTACGGCGCCAAGCTGCGCGCCAAGTCCAAGTTCAGC
GCTTGA
Transcript >Hirsu2|992
ATGGTCCCTGGCGCCGTCCTCGTCCCCGTCGGCCTGCTTGTCTACTCGTGGACGGCCGAGTCACGGATACACTGG
GTCGGGCCCAACGTCGGCGCCGCCATCTACGCCGCCGGCACCATCGCTAGCTTCCAGTGTGTCCAGGGCTATACG
GTCGGCTCCTACAGCCGCTACGCCGCCGGCGCCGTCGGCGTCATCACCGTCCTTCGCAGCCTGGCTGGCTTCGGC
TTTCCGCTCTTCGCCCCCTATATGTACGAAAGCCTGGGCTACGGCAACGGAGGGACCGTCCTAGCGGCCTGTGCC
GTCGCTATCGGCTGGCCGAGCCCCGCGCTGCTTTGGTTGTACGGCGCCAAGCTGCGCGCCAAGTCCAAGTTCAGC
GCTTGA
Gene >Hirsu2|992
ATGGTCCCTGGCGCCGTCCTCGTCCCCGTCGGCCTGCTTGTCTACTCGTGGACGGCCGAGTCACGGATACACTGG
GTCGGGCCCAACGTCGGCGCCGCCATCTACGCCGCCGGCACCATCGCTAGCTTCCAGTGTGTCCAGGGCTATACG
GTCGGCTCCTACAGCCGCTACGCCGCCGGCGCCGTCGGCGTCATCACCGTCCTTCGCAGCCTGGCTGGCTTCGGC
TTTCCGCTCTTCGCCCCCTATATGTACGAAAGCCTGGGCTACGGCAACGGAGGGACCGTCCTAGCGGCCTGTGCC
GTCGCTATCGGCTGGCCGAGCCCCGCGCTGCTTTGGTTGTACGGCGCCAAGCTGCGCGCCAAGTCCAAGTTCAGC
GCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail