Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9918
Gene name
LocationContig_759:3245..4183
Strand-
Gene length (bp)938
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17135 Ribosomal_L18 Ribosomal protein 60S L18 and 50S L18e 3.5E-92 2 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TFH1|RL18B_SCHPO 60S ribosomal protein L18-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1802 PE=1 SV=1 1 184 9.0E-94
sp|Q10192|RL18A_SCHPO 60S ribosomal protein L18-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1801 PE=1 SV=1 1 184 1.0E-86
sp|P0CX49|RL18A_YEAST 60S ribosomal protein L18-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL18A PE=1 SV=1 1 184 5.0E-80
sp|P0CX50|RL18B_YEAST 60S ribosomal protein L18-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL18B PE=1 SV=1 1 184 5.0E-80
sp|Q4GXG7|RL18_TIMBA 60S ribosomal protein L18 OS=Timarcha balearica GN=RpL18 PE=2 SV=1 1 183 4.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TFH1|RL18B_SCHPO 60S ribosomal protein L18-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1802 PE=1 SV=1 1 184 9.0E-94
sp|Q10192|RL18A_SCHPO 60S ribosomal protein L18-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1801 PE=1 SV=1 1 184 1.0E-86
sp|P0CX49|RL18A_YEAST 60S ribosomal protein L18-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL18A PE=1 SV=1 1 184 5.0E-80
sp|P0CX50|RL18B_YEAST 60S ribosomal protein L18-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL18B PE=1 SV=1 1 184 5.0E-80
sp|Q4GXG7|RL18_TIMBA 60S ribosomal protein L18 OS=Timarcha balearica GN=RpL18 PE=2 SV=1 1 183 4.0E-75
sp|Q9VS34|RL18_DROME 60S ribosomal protein L18 OS=Drosophila melanogaster GN=RpL18 PE=1 SV=1 1 183 9.0E-73
sp|P42791|RL182_ARATH 60S ribosomal protein L18-2 OS=Arabidopsis thaliana GN=RPL18B PE=1 SV=2 1 184 7.0E-72
sp|Q940B0|RL183_ARATH 60S ribosomal protein L18-3 OS=Arabidopsis thaliana GN=RPL18C PE=2 SV=1 1 184 2.0E-70
sp|O65729|RL18_CICAR 60S ribosomal protein L18 (Fragment) OS=Cicer arietinum GN=RPL18 PE=2 SV=1 11 184 3.0E-69
sp|Q0PXY6|RL18_DIACI 60S ribosomal protein L18 OS=Diaphorina citri GN=RpL18 PE=2 SV=1 1 183 9.0E-69
sp|Q56FG8|RL18_LYSTE 60S ribosomal protein L18 OS=Lysiphlebus testaceipes GN=RpL18 PE=2 SV=1 1 183 9.0E-67
sp|Q1HR62|RL18_AEDAE 60S ribosomal protein L18 OS=Aedes aegypti GN=RpL18 PE=2 SV=1 1 183 2.0E-66
sp|O22254|RL181_ARATH Putative 60S ribosomal protein L18-1 OS=Arabidopsis thaliana GN=RPL18A PE=2 SV=3 1 184 3.0E-66
sp|Q90YV0|RL18_ICTPU 60S ribosomal protein L18 OS=Ictalurus punctatus GN=rpl18 PE=2 SV=3 1 171 4.0E-66
sp|Q7QJM5|RL18_ANOGA 60S ribosomal protein L18 OS=Anopheles gambiae GN=RpL18 PE=3 SV=3 1 183 3.0E-65
sp|P12001|RL18_RAT 60S ribosomal protein L18 OS=Rattus norvegicus GN=Rpl18 PE=1 SV=2 1 171 5.0E-65
sp|Q4R5H8|RL18_MACFA 60S ribosomal protein L18 OS=Macaca fascicularis GN=RPL18 PE=2 SV=1 1 171 2.0E-64
sp|Q07020|RL18_HUMAN 60S ribosomal protein L18 OS=Homo sapiens GN=RPL18 PE=1 SV=2 1 171 2.0E-64
sp|Q60P81|RL18_CAEBR 60S ribosomal protein L18 OS=Caenorhabditis briggsae GN=rpl-18 PE=3 SV=1 1 171 4.0E-64
sp|D0VWQ3|RL18_CANLF Ribosomal protein L18 OS=Canis lupus familiaris GN=RPL18 PE=1 SV=2 1 171 5.0E-64
sp|Q5E973|RL18_BOVIN 60S ribosomal protein L18 OS=Bos taurus GN=RPL18 PE=2 SV=3 1 171 7.0E-64
sp|Q2M0G4|RL18_DROPS 60S ribosomal protein L18 OS=Drosophila pseudoobscura pseudoobscura GN=RpL18 PE=3 SV=2 2 183 8.0E-64
sp|O45946|RL18_CAEEL 60S ribosomal protein L18 OS=Caenorhabditis elegans GN=rpl-18 PE=3 SV=1 1 171 1.0E-63
sp|Q962Y8|RL18_SPOFR 60S ribosomal protein L18 OS=Spodoptera frugiperda GN=RpL18 PE=2 SV=1 1 179 2.0E-63
sp|P02412|RL18B_XENLA 60S ribosomal protein L18-B OS=Xenopus laevis GN=rpl18-b PE=2 SV=4 1 171 4.0E-63
sp|Q4PM04|RL18_IXOSC 60S ribosomal protein L18 OS=Ixodes scapularis GN=RpL18 PE=2 SV=1 1 171 4.0E-63
sp|P09897|RL18A_XENLA 60S ribosomal protein L18-A OS=Xenopus laevis GN=rpl18-a PE=2 SV=2 1 171 9.0E-63
sp|P69091|RL18_ORENI 60S ribosomal protein L18 OS=Oreochromis niloticus GN=rpl18 PE=2 SV=2 1 183 1.0E-62
sp|P69090|RL18_OREMO 60S ribosomal protein L18 OS=Oreochromis mossambicus GN=rpl18 PE=3 SV=2 1 183 1.0E-62
sp|Q6F442|RL18_PLUXY 60S ribosomal protein L18 OS=Plutella xylostella GN=RpL18 PE=2 SV=1 1 179 3.0E-62
sp|Q5UAS1|RL18_BOMMO 60S ribosomal protein L18 OS=Bombyx mori GN=RpL18 PE=2 SV=1 1 179 3.0E-62
sp|P0DJ17|RL18_TETTH 60S ribosomal protein L18 OS=Tetrahymena thermophila GN=RPL18 PE=1 SV=1 1 175 2.0E-60
sp|Q4N438|RL18_THEPA 60S ribosomal protein L18 OS=Theileria parva GN=RPL18 PE=3 SV=1 1 184 3.0E-60
sp|Q54VZ4|RL18_DICDI 60S ribosomal protein L18 OS=Dictyostelium discoideum GN=rpl18 PE=1 SV=1 1 176 3.0E-57
sp|P35980|RL18_MOUSE 60S ribosomal protein L18 OS=Mus musculus GN=Rpl18 PE=1 SV=3 1 171 4.0E-57
sp|A3F4S0|RL18_TAEAS 60S ribosomal protein L18 OS=Taenia asiatica GN=RPL18 PE=2 SV=1 1 169 2.0E-56
sp|Q4UFD5|RL18_THEAN 60S ribosomal protein L18 OS=Theileria annulata GN=RPL18 PE=3 SV=2 1 183 3.0E-56
sp|P50885|RL18_TRYB2 60S ribosomal protein L18 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=RPL18-A PE=1 SV=1 1 177 3.0E-49
sp|Q4DZP2|RL18_TRYCC 60S ribosomal protein L18 OS=Trypanosoma cruzi (strain CL Brener) GN=RPL18 PE=3 SV=1 1 169 2.0E-46
sp|Q4QG98|RL18_LEIMA 60S ribosomal protein L18 OS=Leishmania major GN=RPL18-A PE=3 SV=1 1 183 6.0E-42
sp|Q95342|RL18_PIG 60S ribosomal protein L18 (Fragment) OS=Sus scrofa GN=RPL18 PE=2 SV=3 1 103 5.0E-33
sp|P24558|RL18_SALSA 60S ribosomal protein L18 OS=Salmo salar GN=rpl18 PE=2 SV=1 1 165 8.0E-23
sp|B6YSQ4|RL18E_THEON 50S ribosomal protein L18e OS=Thermococcus onnurineus (strain NA1) GN=rpl18e PE=3 SV=1 28 138 3.0E-10
sp|Q8U0E5|RL18E_PYRFU 50S ribosomal protein L18e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl18e PE=1 SV=1 28 138 5.0E-10
sp|O59302|RL18E_PYRHO 50S ribosomal protein L18e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl18e PE=3 SV=1 28 138 2.0E-09
sp|Q5JJF5|RL18E_THEKO 50S ribosomal protein L18e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl18e PE=3 SV=1 22 138 2.0E-09
sp|Q9V197|RL18E_PYRAB 50S ribosomal protein L18e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl18e PE=3 SV=1 28 138 5.0E-09
sp|Q2FTA2|RL18E_METHJ 50S ribosomal protein L18e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl18e PE=3 SV=1 22 139 7.0E-07
sp|O26145|RL18E_METTH 50S ribosomal protein L18e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl18e PE=3 SV=1 28 138 1.0E-06
sp|Q8TVB7|RL18E_METKA 50S ribosomal protein L18e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl18e PE=3 SV=1 22 138 1.0E-06
sp|P54022|RL18E_METJA 50S ribosomal protein L18e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl18e PE=3 SV=2 28 138 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9918
MGIDLDRHHVKATHRKAPKSDNVYLKLLVKLYRFLARRTDAAFNKVVLRRLFMSKTNRPPVSLSRIASNVNKEGE
KRTVVVVGTVTDDNRLLAVPKLTIAALRFTSTARARILAAGGEAMTLDQLALRAPTGSNTLILRGPKNSREAFKH
FGFGPHKHKKPQIESKGRKFERARGRRRSRGFKV*
Coding >Hirsu2|9918
ATGGGTATCGATCTCGACCGCCACCACGTCAAGGCCACGCACCGCAAGGCCCCCAAGAGCGACAATGTCTACCTC
AAGCTCTTGGTGAAGCTGTACCGCTTCCTGGCTCGCCGTACCGACGCCGCCTTCAACAAGGTCGTCCTCCGCCGG
CTGTTCATGTCCAAGACGAACCGGCCGCCGGTGTCGCTGTCGCGCATCGCGTCCAACGTCAACAAGGAGGGCGAG
AAGCGCACCGTCGTCGTCGTCGGCACCGTCACCGACGACAACCGCCTGCTGGCGGTGCCCAAGCTGACCATCGCC
GCCCTGCGCTTCACCTCGACGGCCCGCGCCCGCATCCTCGCCGCCGGGGGCGAGGCCATGACGCTCGACCAGCTG
GCCCTCCGCGCGCCCACCGGCAGCAACACGCTGATCCTCCGCGGGCCCAAGAACAGCCGCGAGGCCTTCAAGCAC
TTCGGCTTCGGCCCTCACAAGCACAAGAAACCGCAAATCGAGTCCAAGGGCCGCAAGTTCGAGCGCGCCCGTGGT
CGCAGACGCTCTCGCGGCTTCAAGGTCTAA
Transcript >Hirsu2|9918
ATGGGTATCGATCTCGACCGCCACCACGTCAAGGCCACGCACCGCAAGGCCCCCAAGAGCGACAATGTCTACCTC
AAGCTCTTGGTGAAGCTGTACCGCTTCCTGGCTCGCCGTACCGACGCCGCCTTCAACAAGGTCGTCCTCCGCCGG
CTGTTCATGTCCAAGACGAACCGGCCGCCGGTGTCGCTGTCGCGCATCGCGTCCAACGTCAACAAGGAGGGCGAG
AAGCGCACCGTCGTCGTCGTCGGCACCGTCACCGACGACAACCGCCTGCTGGCGGTGCCCAAGCTGACCATCGCC
GCCCTGCGCTTCACCTCGACGGCCCGCGCCCGCATCCTCGCCGCCGGGGGCGAGGCCATGACGCTCGACCAGCTG
GCCCTCCGCGCGCCCACCGGCAGCAACACGCTGATCCTCCGCGGGCCCAAGAACAGCCGCGAGGCCTTCAAGCAC
TTCGGCTTCGGCCCTCACAAGCACAAGAAACCGCAAATCGAGTCCAAGGGCCGCAAGTTCGAGCGCGCCCGTGGT
CGCAGACGCTCTCGCGGCTTCAAGGTCTAA
Gene >Hirsu2|9918
ATGGGTACGTGATGCTGCCCCGTCCCAGCCTAAGTGTGCGAGTGAGGCCGGGCCGCCGGGCGAGTCGTCGCGAGA
CGGCCTCTCGCCGGGCGCCCGTTCCTTGCGTCCCCCCCGCGGGCGCGGCCGCCGCGCCGCCCGCTTGTTGAGCAT
GCCGGGACCGCCCCAAACGGCTGACGATGGGCTTTCCTCTCCTCCGTCCGCGCGAGCCAGGTATCGATCTCGACC
GCCACCACGTCAAGGCCACGCACCGCAAGGCCCCCAAGAGCGACAATGTCTACCTCAAGCTCTTGGTGAAGCTGT
ACCGCTTCCTGGCTCGTACGTGTCCCCCGTCCCGCGCCGCCCTCTTCCGAGCGGAAGGCGAAGTTGAGGGCTTGC
TTGCTGACCACGGCGGGACCGTTCTCCTTGGGGACGGTCGGATTGGGGGGCAACGCACAGGCCGTACCGACGCCG
CCTTCAACAAGGTCGTCCTCCGCCGGCTGTTCATGTCCAAGACGAACCGGCCGCCGGTGTCGCTGTCGCGCATCG
CGTCCAACGTCAACAAGGAGGGCGAGAAGCGCACCGTCGTCGTCGTCGGCACCGTCACCGACGACAACCGCCTGC
TGGCGGTGCCCAAGCTGACCATCGCCGCCCTGCGCTTCACCTCGACGGCCCGCGCCCGCATCCTCGCCGCCGGGG
GCGAGGCCATGACGCTCGACCAGCTGGCCCTCCGCGCGCCCACCGGCAGCAACACGCTGATCCTCCGCGGGCCCA
AGAACAGCCGCGAGGCCTTCAAGCACTTCGGCTTCGGCCCTCACAAGCACAAGGTACGTGGTTTCGCGAGCGGCG
TCTGGCCAGGCTCGACTGACCTTGTCGGCCTGCAGAAACCGCAAATCGAGTCCAAGGGCCGCAAGTTCGAGCGCG
CCCGTGGTCGCAGACGCTCTCGCGGCTTCAAGGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail