Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9904
Gene name
LocationContig_756:6089..6917
Strand+
Gene length (bp)828
Transcript length (bp)771
Coding sequence length (bp)771
Protein length (aa) 257

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 3.0E-08 157 213
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 3.9E-08 160 214
PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain 9.2E-07 156 215
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 3.2E-05 161 215

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59806|YJV8_SCHPO Uncharacterized N-acetyltransferase C550.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.08 PE=3 SV=1 28 237 2.0E-41
sp|P13249|PUAC_STRAD Puromycin N-acetyltransferase OS=Streptomyces alboniger GN=pac PE=3 SV=2 159 237 3.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9904
MEQPSAARPAAASERQSLIPPAWTSTVREIGMSERREASFSLAAAFAADPLSLYLLAGEDAAGLAPERVWDLHLR
VMSCTFAAYRIRGVVTTIGADYDAIALWTPPGKFMDDWWATLRSGTWRLAYQLPAEARARFFDELAPALHKTREE
TMGPRNNDAYYLGYIGTKPSARGKGYASTLIRHMTDKADAENRPMYLESSASDNIGFYAKFGFEIKSHIDLTRGP
APVRLYCMVREPRPSRLQASVTESSTEADKP*
Coding >Hirsu2|9904
ATGGAGCAACCCAGCGCCGCGCGACCCGCTGCCGCCTCCGAGCGCCAGTCCTTGATCCCCCCGGCCTGGACGTCG
ACCGTGCGCGAGATCGGCATGAGTGAGCGCCGCGAGGCCAGCTTCTCGCTCGCCGCCGCCTTCGCCGCCGACCCG
CTGAGCCTCTACCTCCTGGCCGGCGAGGACGCGGCCGGCCTGGCGCCCGAGCGCGTCTGGGACCTGCACCTGCGC
GTCATGAGCTGCACCTTCGCCGCCTACCGCATCCGCGGCGTCGTCACCACCATCGGCGCCGACTACGACGCCATC
GCCCTGTGGACGCCGCCCGGCAAGTTCATGGACGACTGGTGGGCCACGCTGCGCAGCGGCACCTGGCGCCTCGCC
TACCAGCTGCCGGCCGAGGCCCGCGCCCGCTTCTTCGACGAGCTCGCGCCCGCCCTGCACAAGACGCGCGAGGAG
ACGATGGGGCCGCGCAACAACGACGCCTACTACCTCGGCTACATCGGCACCAAGCCCAGCGCCCGCGGCAAGGGC
TACGCCTCGACGCTCATCCGCCACATGACGGACAAGGCCGACGCCGAGAACCGGCCCATGTACCTCGAGTCGTCG
GCCAGCGACAACATCGGCTTCTACGCCAAGTTCGGCTTCGAGATCAAGTCGCACATCGACCTCACCCGCGGGCCC
GCCCCCGTCCGCCTCTACTGCATGGTCCGCGAGCCGCGGCCCAGCCGCCTCCAGGCCTCCGTCACCGAGTCGTCC
ACCGAGGCCGACAAGCCGTGA
Transcript >Hirsu2|9904
ATGGAGCAACCCAGCGCCGCGCGACCCGCTGCCGCCTCCGAGCGCCAGTCCTTGATCCCCCCGGCCTGGACGTCG
ACCGTGCGCGAGATCGGCATGAGTGAGCGCCGCGAGGCCAGCTTCTCGCTCGCCGCCGCCTTCGCCGCCGACCCG
CTGAGCCTCTACCTCCTGGCCGGCGAGGACGCGGCCGGCCTGGCGCCCGAGCGCGTCTGGGACCTGCACCTGCGC
GTCATGAGCTGCACCTTCGCCGCCTACCGCATCCGCGGCGTCGTCACCACCATCGGCGCCGACTACGACGCCATC
GCCCTGTGGACGCCGCCCGGCAAGTTCATGGACGACTGGTGGGCCACGCTGCGCAGCGGCACCTGGCGCCTCGCC
TACCAGCTGCCGGCCGAGGCCCGCGCCCGCTTCTTCGACGAGCTCGCGCCCGCCCTGCACAAGACGCGCGAGGAG
ACGATGGGGCCGCGCAACAACGACGCCTACTACCTCGGCTACATCGGCACCAAGCCCAGCGCCCGCGGCAAGGGC
TACGCCTCGACGCTCATCCGCCACATGACGGACAAGGCCGACGCCGAGAACCGGCCCATGTACCTCGAGTCGTCG
GCCAGCGACAACATCGGCTTCTACGCCAAGTTCGGCTTCGAGATCAAGTCGCACATCGACCTCACCCGCGGGCCC
GCCCCCGTCCGCCTCTACTGCATGGTCCGCGAGCCGCGGCCCAGCCGCCTCCAGGCCTCCGTCACCGAGTCGTCC
ACCGAGGCCGACAAGCCGTGA
Gene >Hirsu2|9904
ATGGAGCAACCCAGCGCCGCGCGACCCGCTGCCGCCTCCGAGCGCCAGTCCTTGATCCCCCCGGCCTGGACGTCG
ACCGTGCGCGAGATCGGCATGAGTGAGCGCCGCGAGGCCAGCTTCTCGCTCGCCGCCGCCTTCGCCGCCGACCCG
CTGAGCCTCTACCTCCTGGCCGGCGAGGACGCGGCCGGCCTGGCGCCCGAGCGCGTCTGGGACCTGCACCTGCGC
GTCATGAGCTGCACCTTCGCCGCCTACCGCATCCGCGGCGTCGTCACCACCATCGGCGCCGACTACGACGCCATC
GCCCTGTGGTGAGTTGCTCGAGAGCCGGGGAGACACAGAGAAGAGAGGCTGAGGCGGGAAAGCAGGACGCCGCCC
GGCAAGTTCATGGACGACTGGTGGGCCACGCTGCGCAGCGGCACCTGGCGCCTCGCCTACCAGCTGCCGGCCGAG
GCCCGCGCCCGCTTCTTCGACGAGCTCGCGCCCGCCCTGCACAAGACGCGCGAGGAGACGATGGGGCCGCGCAAC
AACGACGCCTACTACCTCGGCTACATCGGCACCAAGCCCAGCGCCCGCGGCAAGGGCTACGCCTCGACGCTCATC
CGCCACATGACGGACAAGGCCGACGCCGAGAACCGGCCCATGTACCTCGAGTCGTCGGCCAGCGACAACATCGGC
TTCTACGCCAAGTTCGGCTTCGAGATCAAGTCGCACATCGACCTCACCCGCGGGCCCGCCCCCGTCCGCCTCTAC
TGCATGGTCCGCGAGCCGCGGCCCAGCCGCCTCCAGGCCTCCGTCACCGAGTCGTCCACCGAGGCCGACAAGCCG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail