Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|99
Gene name
LocationContig_1013:3539..5629
Strand+
Gene length (bp)2090
Transcript length (bp)1959
Coding sequence length (bp)1959
Protein length (aa) 653

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 2.1E-25 8 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q51MB1|PALI_MAGO7 pH-response regulator protein palI/RIM9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM9 PE=3 SV=1 21 312 2.0E-88
sp|Q7Z8R5|PALI_YARLI pH-response regulator protein palI/RIM9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM9 PE=3 SV=3 3 263 2.0E-52
sp|O74472|MUG33_SCHPO Meiotically up-regulated gene 33 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug33 PE=1 SV=1 3 209 2.0E-26
sp|Q7SFN5|PALI_NEUCR pH-response regulator protein palI/prr-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-5 PE=3 SV=2 409 627 3.0E-26
sp|Q6CUG3|PALI2_KLULA pH-response regulator palI/RIM9 homolog 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0C05060g PE=3 SV=1 21 175 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q51MB1|PALI_MAGO7 pH-response regulator protein palI/RIM9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM9 PE=3 SV=1 21 312 2.0E-88
sp|Q7Z8R5|PALI_YARLI pH-response regulator protein palI/RIM9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM9 PE=3 SV=3 3 263 2.0E-52
sp|O74472|MUG33_SCHPO Meiotically up-regulated gene 33 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug33 PE=1 SV=1 3 209 2.0E-26
sp|Q7SFN5|PALI_NEUCR pH-response regulator protein palI/prr-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-5 PE=3 SV=2 409 627 3.0E-26
sp|Q6CUG3|PALI2_KLULA pH-response regulator palI/RIM9 homolog 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0C05060g PE=3 SV=1 21 175 2.0E-21
sp|Q04734|PALI_YEAST pH-response regulator protein palI/RIM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM9 PE=1 SV=1 20 198 1.0E-20
sp|Q759Y2|PALI_ASHGO pH-response regulator protein palI/RIM9 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RIM9 PE=3 SV=1 24 184 1.0E-20
sp|Q6CXZ7|PALI1_KLULA pH-response regulator palI/RIM9 homolog 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0A04389g PE=3 SV=1 20 186 1.0E-19
sp|Q08157|YOL19_YEAST Uncharacterized membrane protein YOL019W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL019W PE=1 SV=1 13 176 4.0E-15
sp|Q10268|MAC1_SCHPO Membrane-anchored protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mac1 PE=1 SV=1 17 227 2.0E-14
sp|Q59WV0|PALI_CANAL pH-response regulator protein palI/RIM9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM9 PE=3 SV=2 1 186 5.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0005575 cellular_component No
GO:0044464 cell part No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 84 106 22
3 119 140 21
4 150 172 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|99
MARPATPLTVLLLVAFALLLLSVLSVPVTKAIPLGSFKDVTFGVFGYCKDGGECSSIGIGYDTGKLLDNDQQAFD
LPVGVRDTVSVILVVHPVAALLALVMFIMGIVAHLHAPAHSSKYLLVLFIFVLISFLVSLLAFIVDVLLFIPHMA
WGSYMVLAATIVLGLSAVASCAMRRAVVSRKAHKKRVGDNAEMSGENYYNRGGSLNYYGADDLSKPSLAVTAEPT
LPMVSGGNAGAGDKLPQFASFEHRNKDDRFSDEMIPLTQRSPSNRSPHAAGDFAAINSAVPPPPSSRDRNPYATT
NSPVDPYGSRRGRGDMGPVGGYGGRGGGGRGYGRGGFDNYGPPTPTRGGYGQGGRGGPPGLRAAYGPPSRGGYGA
GGARGPPPTLNNGPSPYDRRPTVDDGYYGQQKVEYRPYTPATELPRAESPPPLAGNGPARAADNATSRPDETGPY
GRIRGDDTDVAGMVGLQRTRPQARHDTMMTEGSRYSTDEAYVPPRAAWNEDAGRNSPGAGPPSPQQRPDPETSGR
LAPPGGDYYDDVYAAYASPSRPEHQPPPAASYRPEETSAPVGRARSPSESDRSNFTSISQRGVNPRWNANHPGYQ
GPRRVAQQQQQRRRDLLLDNPDFQLPGSRVQGGAHRKGPGMTPGSAYPTTAI*
Coding >Hirsu2|99
ATGGCTCGGCCGGCCACGCCCTTGACCGTCTTGCTGCTCGTCGCCTTCGCCCTGCTGCTGCTGTCCGTCCTGTCC
GTCCCCGTCACCAAGGCCATCCCCCTCGGCTCCTTCAAGGACGTCACCTTTGGCGTCTTTGGCTACTGCAAGGAT
GGCGGCGAATGCAGCTCCATCGGCATAGGATATGACACCGGCAAACTGCTCGACAACGACCAGCAGGCCTTTGAC
CTGCCCGTCGGCGTCCGCGATACCGTTTCCGTCATTCTCGTTGTTCACCCCGTCGCCGCCCTCCTCGCCCTCGTC
ATGTTCATCATGGGCATTGTCGCCCACCTGCATGCGCCCGCCCACTCGTCCAAATACCTCCTCGTCCTCTTCATC
TTCGTCCTCATCAGCTTTCTCGTCTCCCTCCTCGCCTTCATCGTCGACGTCCTCCTCTTCATCCCCCACATGGCT
TGGGGCTCCTACATGGTCCTGGCCGCTACCATCGTCCTCGGCCTGAGCGCCGTCGCCTCGTGCGCCATGCGCCGC
GCCGTCGTCAGCAGAAAGGCCCACAAGAAGCGCGTCGGCGACAATGCCGAGATGAGCGGCGAAAACTACTACAAC
CGAGGCGGCTCGCTCAACTACTACGGCGCCGACGACCTGTCCAAGCCCTCCCTCGCCGTTACCGCCGAGCCCACC
CTGCCCATGGTCAGCGGCGGCAATGCGGGCGCCGGCGACAAGCTGCCCCAGTTCGCCTCCTTTGAGCATCGCAAC
AAGGATGACCGCTTCAGCGACGAGATGATCCCGCTGACCCAGCGCTCCCCCTCCAACAGGTCGCCGCACGCCGCC
GGTGACTTCGCCGCCATCAACAGCGCGGTACCGCCGCCACCGTCGTCCCGAGACCGCAACCCGTATGCGACAACC
AACTCCCCCGTCGACCCCTACGGCAGCCGCAGGGGCAGAGGAGACATGGGTCCCGTCGGCGGCTACGGAGGCCGG
GGCGGAGGCGGCCGAGGATATGGACGCGGGGGCTTCGACAACTACGGGCCTCCGACGCCGACCAGAGGAGGCTAC
GGTCAAGGCGGCCGGGGCGGCCCTCCCGGCCTGAGAGCAGCATACGGCCCTCCGTCGCGCGGCGGCTACGGAGCT
GGAGGGGCCCGAGGCCCGCCCCCGACCTTGAACAACGGCCCGAGCCCGTACGACCGGAGGCCGACAGTCGATGAC
GGGTACTACGGGCAGCAAAAGGTCGAGTACCGGCCCTACACGCCCGCGACCGAGCTCCCGAGAGCAGAGTCGCCG
CCACCGCTCGCAGGCAACGGCCCCGCGAGGGCGGCGGACAACGCGACGAGCCGACCCGACGAGACGGGCCCGTAC
GGCCGGATCCGCGGTGACGACACCGACGTGGCCGGCATGGTGGGTCTGCAACGGACGCGCCCTCAGGCCCGCCAC
GACACGATGATGACGGAGGGAAGCCGATACAGCACTGACGAGGCCTACGTACCGCCCCGCGCGGCGTGGAACGAG
GACGCGGGGAGGAACTCGCCCGGGGCCGGGCCGCCGAGTCCGCAGCAGCGCCCAGACCCCGAGACGTCCGGACGG
CTGGCGCCGCCGGGCGGCGACTACTACGACGATGTGTACGCGGCGTACGCCAGCCCGTCGCGGCCCGAGCACCAG
CCTCCGCCCGCGGCCAGCTACCGTCCCGAGGAGACGAGCGCGCCGGTGGGCAGGGCCCGCAGCCCGTCCGAATCG
GACCGCTCCAACTTCACGTCCATCTCGCAGAGGGGCGTCAATCCCCGATGGAACGCCAACCACCCGGGGTACCAG
GGCCCGCGGCGCGTGGCCCAGCAGCAACAGCAACGGCGGCGGGACCTGCTGCTGGACAACCCGGACTTCCAACTG
CCCGGAAGCCGCGTCCAGGGAGGAGCACATAGGAAAGGGCCCGGCATGACTCCGGGCAGCGCCTATCCCACCACC
GCGATATAG
Transcript >Hirsu2|99
ATGGCTCGGCCGGCCACGCCCTTGACCGTCTTGCTGCTCGTCGCCTTCGCCCTGCTGCTGCTGTCCGTCCTGTCC
GTCCCCGTCACCAAGGCCATCCCCCTCGGCTCCTTCAAGGACGTCACCTTTGGCGTCTTTGGCTACTGCAAGGAT
GGCGGCGAATGCAGCTCCATCGGCATAGGATATGACACCGGCAAACTGCTCGACAACGACCAGCAGGCCTTTGAC
CTGCCCGTCGGCGTCCGCGATACCGTTTCCGTCATTCTCGTTGTTCACCCCGTCGCCGCCCTCCTCGCCCTCGTC
ATGTTCATCATGGGCATTGTCGCCCACCTGCATGCGCCCGCCCACTCGTCCAAATACCTCCTCGTCCTCTTCATC
TTCGTCCTCATCAGCTTTCTCGTCTCCCTCCTCGCCTTCATCGTCGACGTCCTCCTCTTCATCCCCCACATGGCT
TGGGGCTCCTACATGGTCCTGGCCGCTACCATCGTCCTCGGCCTGAGCGCCGTCGCCTCGTGCGCCATGCGCCGC
GCCGTCGTCAGCAGAAAGGCCCACAAGAAGCGCGTCGGCGACAATGCCGAGATGAGCGGCGAAAACTACTACAAC
CGAGGCGGCTCGCTCAACTACTACGGCGCCGACGACCTGTCCAAGCCCTCCCTCGCCGTTACCGCCGAGCCCACC
CTGCCCATGGTCAGCGGCGGCAATGCGGGCGCCGGCGACAAGCTGCCCCAGTTCGCCTCCTTTGAGCATCGCAAC
AAGGATGACCGCTTCAGCGACGAGATGATCCCGCTGACCCAGCGCTCCCCCTCCAACAGGTCGCCGCACGCCGCC
GGTGACTTCGCCGCCATCAACAGCGCGGTACCGCCGCCACCGTCGTCCCGAGACCGCAACCCGTATGCGACAACC
AACTCCCCCGTCGACCCCTACGGCAGCCGCAGGGGCAGAGGAGACATGGGTCCCGTCGGCGGCTACGGAGGCCGG
GGCGGAGGCGGCCGAGGATATGGACGCGGGGGCTTCGACAACTACGGGCCTCCGACGCCGACCAGAGGAGGCTAC
GGTCAAGGCGGCCGGGGCGGCCCTCCCGGCCTGAGAGCAGCATACGGCCCTCCGTCGCGCGGCGGCTACGGAGCT
GGAGGGGCCCGAGGCCCGCCCCCGACCTTGAACAACGGCCCGAGCCCGTACGACCGGAGGCCGACAGTCGATGAC
GGGTACTACGGGCAGCAAAAGGTCGAGTACCGGCCCTACACGCCCGCGACCGAGCTCCCGAGAGCAGAGTCGCCG
CCACCGCTCGCAGGCAACGGCCCCGCGAGGGCGGCGGACAACGCGACGAGCCGACCCGACGAGACGGGCCCGTAC
GGCCGGATCCGCGGTGACGACACCGACGTGGCCGGCATGGTGGGTCTGCAACGGACGCGCCCTCAGGCCCGCCAC
GACACGATGATGACGGAGGGAAGCCGATACAGCACTGACGAGGCCTACGTACCGCCCCGCGCGGCGTGGAACGAG
GACGCGGGGAGGAACTCGCCCGGGGCCGGGCCGCCGAGTCCGCAGCAGCGCCCAGACCCCGAGACGTCCGGACGG
CTGGCGCCGCCGGGCGGCGACTACTACGACGATGTGTACGCGGCGTACGCCAGCCCGTCGCGGCCCGAGCACCAG
CCTCCGCCCGCGGCCAGCTACCGTCCCGAGGAGACGAGCGCGCCGGTGGGCAGGGCCCGCAGCCCGTCCGAATCG
GACCGCTCCAACTTCACGTCCATCTCGCAGAGGGGCGTCAATCCCCGATGGAACGCCAACCACCCGGGGTACCAG
GGCCCGCGGCGCGTGGCCCAGCAGCAACAGCAACGGCGGCGGGACCTGCTGCTGGACAACCCGGACTTCCAACTG
CCCGGAAGCCGCGTCCAGGGAGGAGCACATAGGAAAGGGCCCGGCATGACTCCGGGCAGCGCCTATCCCACCACC
GCGATATAG
Gene >Hirsu2|99
ATGGCTCGGCCGGCCACGCCCTTGACCGTCTTGCTGCTCGTCGCCTTCGCCCTGCTGCTGCTGTCCGTCCTGTCC
GTCCCCGTCACCAAGGCCATCCCCCTCGGCTCCTTCAAGGACGTCACCTTTGGCGTCTTTGGCTACTGCAAGGAT
GGCGGCGAATGCAGCTCCATCGGCATAGGATATGACACCGGTATGCCGCCCGCCCCGTCGCCTCGCTCCTCTCCG
CTGACCTCGCACCAGGCAAACTGCTCGACAACGACCAGCAGGCCTTTGACCTGCCCGTCGGCGTCCGCGATACCG
TTTCCGTCATTCTCGTTGTTCACCCCGTCGCCGCCCTCCTCGCCCTCGTCATGTTCATCATGGGCATTGTCGCCC
ACCTGCATGCGCCCGCCCACTCGTCCAAATACCTCCTCGTCCTCTTCATCTTCGTCCTCATCAGCTTTCTCGTCT
CCCTCCTCGCCTTCATCGTCGACGTCCTCCTCTTCATCCCCCACATGGCTTGGGGCTCCTACATGGTCCTGGCCG
CTACCATCGTCCTCGGCCTGAGCGCCGTCGCCTCGTGCGCCATGCGCCGCGCCGTCGTCAGCAGAAAGGCCCACA
AGAAGCGCGTCGGCGACAATGCCGAGATGAGCGGCGAAAACTACTACAACCGAGGCGGCTCGCTCAACTACTACG
GCGCCGACGACCTGTCCAAGCCCTCCCTCGCCGTTACCGCCGAGCCCACCCTGCCCATGGTCAGCGGCGGCAATG
CGGGCGCCGGCGACAAGCTGCCCCAGTTCGCCTCCTTTGAGCATCGCAACAAGGATGACCGCTTCAGCGACGAGA
TGATCCCGCTGACCCAGCGCTCCCCCTCCAACAGGTCGCCGCACGCCGCCGGTGACTTCGCCGCCATCAACAGCG
CGGTACCGCCGCCACCGTCGTCCCGAGACCGCAACCCGTATGCGACAACCAACTCCCCCGTCGACCCCTACGGCA
GCCGCAGGGGCAGAGGAGACATGGGTCCCGTCGGCGGCTACGGAGGCCGGGGCGGAGGCGGCCGAGGATATGGAC
GCGGGGGCTTCGACAACTACGGGCCTCCGACGCCGACCAGAGGAGGCTACGGTCAAGGCGGCCGGGGCGGCCCTC
CCGGCCTGAGAGCAGCATACGGCCCTCCGTCGCGCGGCGGCTACGGAGCTGGAGGGGCCCGAGGCCCGCCCCCGA
CCTTGAACAACGGCCCGAGCCCGTACGACCGGAGGCCGACAGTCGATGACGGGTACTACGGGCAGCAAAAGGTCG
AGTACCGGCCCTACACGCCCGCGACCGAGCTCCCGAGAGCAGAGTCGCCGCCACCGCTCGCAGGCAACGGCCCCG
CGAGGGCGGCGGACAACGCGACGAGCCGACCCGACGAGACGGGCCCGTACGGCCGGATCCGCGGTGACGACACCG
ACGTGGCCGGCATGGTGGGTCTGCAACGGACGCGCCCTCAGGCCCGCCACGACACGATGATGACGGAGGGAAGCC
GATACAGCACTGACGAGTAAGTGACCCGGCCTTCCCCACATCGATGGCTCCTCTGGTCTCCTCGGTGCGAGCGGG
TGACTGACTGGTTGCTCGCCAGGGCCTACGTACCGCCCCGCGCGGCGTGGAACGAGGACGCGGGGAGGAACTCGC
CCGGGGCCGGGCCGCCGAGTCCGCAGCAGCGCCCAGACCCCGAGACGTCCGGACGGCTGGCGCCGCCGGGCGGCG
ACTACTACGACGATGTGTACGCGGCGTACGCCAGCCCGTCGCGGCCCGAGCACCAGCCTCCGCCCGCGGCCAGCT
ACCGTCCCGAGGAGACGAGCGCGCCGGTGGGCAGGGCCCGCAGCCCGTCCGAATCGGACCGCTCCAACTTCACGT
CCATCTCGCAGAGGGGCGTCAATCCCCGATGGAACGCCAACCACCCGGGGTACCAGGGCCCGCGGCGCGTGGCCC
AGCAGCAACAGCAACGGCGGCGGGACCTGCTGCTGGACAACCCGGACTTCCAACTGCCCGGAAGCCGCGTCCAGG
GAGGAGCACATAGGAAAGGGCCCGGCATGACTCCGGGCAGCGCCTATCCCACCACCGCGATATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail