Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9899
Gene name
LocationContig_755:10654..11672
Strand-
Gene length (bp)1018
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01956 EMC3_TMCO1 Integral membrane protein EMC3/TMCO1-like 4.3E-51 10 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P787|YNY3_SCHPO ER membrane protein complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.03 PE=3 SV=1 6 255 7.0E-76
sp|Q5R7C1|EMC3_PONAB ER membrane protein complex subunit 3 OS=Pongo abelii GN=EMC3 PE=2 SV=3 12 255 4.0E-54
sp|Q9P0I2|EMC3_HUMAN ER membrane protein complex subunit 3 OS=Homo sapiens GN=EMC3 PE=1 SV=3 12 255 4.0E-54
sp|Q5U2V8|EMC3_RAT ER membrane protein complex subunit 3 OS=Rattus norvegicus GN=Emc3 PE=2 SV=3 12 255 4.0E-54
sp|Q99KI3|EMC3_MOUSE ER membrane protein complex subunit 3 OS=Mus musculus GN=Emc3 PE=1 SV=3 12 255 4.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P787|YNY3_SCHPO ER membrane protein complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.03 PE=3 SV=1 6 255 7.0E-76
sp|Q5R7C1|EMC3_PONAB ER membrane protein complex subunit 3 OS=Pongo abelii GN=EMC3 PE=2 SV=3 12 255 4.0E-54
sp|Q9P0I2|EMC3_HUMAN ER membrane protein complex subunit 3 OS=Homo sapiens GN=EMC3 PE=1 SV=3 12 255 4.0E-54
sp|Q5U2V8|EMC3_RAT ER membrane protein complex subunit 3 OS=Rattus norvegicus GN=Emc3 PE=2 SV=3 12 255 4.0E-54
sp|Q99KI3|EMC3_MOUSE ER membrane protein complex subunit 3 OS=Mus musculus GN=Emc3 PE=1 SV=3 12 255 4.0E-54
sp|Q3ZCB8|EMC3_BOVIN ER membrane protein complex subunit 3 OS=Bos taurus GN=EMC3 PE=2 SV=3 12 255 4.0E-54
sp|Q7SXW4|EMC3_DANRE ER membrane protein complex subunit 3 OS=Danio rerio GN=emc3 PE=2 SV=1 12 255 2.0E-51
sp|B5VLV9|EMC3_YEAS6 ER membrane protein complex subunit 3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM27 PE=3 SV=2 12 256 2.0E-49
sp|B3LQQ2|EMC3_YEAS1 ER membrane protein complex subunit 3 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM27 PE=3 SV=2 12 256 2.0E-49
sp|P36039|EMC3_YEAST ER membrane protein complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC3 PE=1 SV=3 12 256 5.0E-49
sp|A7A082|EMC3_YEAS7 ER membrane protein complex subunit 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM27 PE=3 SV=2 12 256 5.0E-49
sp|Q54YN3|EMC3_DICDI ER membrane protein complex subunit 3 OS=Dictyostelium discoideum GN=emc3 PE=3 SV=1 12 259 9.0E-36
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 126 148 22
3 175 197 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9899
MAQVPIQTLHRDPQLFYWILIPITIVMVLTGVLRHYASVLMATAPKRLDTRAMRELRALARGVALRSNFHVLSRR
AFETRRDALATGYESGAFLKEPERKGQPPANPLTDPSQMDGMMGMMKNNMAMIIPNTLIMSWINAFFSGYVIMKL
PFPITIKFKSMLQAGVQTKDMDPRWMSSISWYFLCIFGLQFVYVFLLGSDNAASQMAQQMAAQQMPMAGMGGPGQ
DPDKQFKTEAENLAVVEHYSVLDGVEERLLEGIRS*
Coding >Hirsu2|9899
ATGGCCCAAGTCCCGATTCAGACACTCCATCGGGATCCCCAGCTCTTCTACTGGATCCTGATCCCCATCACCATC
GTCATGGTCCTGACGGGCGTCCTGCGCCACTACGCCTCGGTCCTCATGGCCACGGCGCCCAAGCGGCTGGACACG
CGGGCCATGCGCGAGCTGCGCGCCCTCGCCCGCGGCGTCGCCCTGCGCTCCAACTTCCACGTCCTCTCCCGCCGC
GCCTTCGAGACCCGCCGCGACGCCCTCGCCACCGGCTACGAGTCGGGCGCCTTCCTCAAGGAGCCCGAGCGCAAG
GGCCAGCCGCCCGCCAACCCGCTGACCGACCCGAGTCAGATGGACGGCATGATGGGCATGATGAAGAACAACATG
GCCATGATCATCCCCAACACACTCATCATGAGCTGGATCAACGCCTTCTTCAGCGGCTACGTCATCATGAAATTG
CCGTTCCCCATCACCATCAAGTTCAAGAGCATGCTGCAGGCGGGCGTGCAGACGAAGGACATGGACCCGCGGTGG
ATGTCGAGCATCAGCTGGTACTTCCTCTGCATCTTTGGCCTGCAGTTTGTCTACGTCTTCCTGCTCGGCAGCGAC
AATGCCGCCAGTCAGATGGCCCAGCAGATGGCTGCGCAGCAGATGCCCATGGCCGGCATGGGCGGCCCCGGCCAG
GACCCGGACAAGCAGTTCAAGACCGAGGCCGAGAATCTCGCCGTCGTGGAGCACTACTCGGTTCTGGACGGCGTC
GAGGAACGTCTTCTCGAGGGTATCAGGTCATAG
Transcript >Hirsu2|9899
ATGGCCCAAGTCCCGATTCAGACACTCCATCGGGATCCCCAGCTCTTCTACTGGATCCTGATCCCCATCACCATC
GTCATGGTCCTGACGGGCGTCCTGCGCCACTACGCCTCGGTCCTCATGGCCACGGCGCCCAAGCGGCTGGACACG
CGGGCCATGCGCGAGCTGCGCGCCCTCGCCCGCGGCGTCGCCCTGCGCTCCAACTTCCACGTCCTCTCCCGCCGC
GCCTTCGAGACCCGCCGCGACGCCCTCGCCACCGGCTACGAGTCGGGCGCCTTCCTCAAGGAGCCCGAGCGCAAG
GGCCAGCCGCCCGCCAACCCGCTGACCGACCCGAGTCAGATGGACGGCATGATGGGCATGATGAAGAACAACATG
GCCATGATCATCCCCAACACACTCATCATGAGCTGGATCAACGCCTTCTTCAGCGGCTACGTCATCATGAAATTG
CCGTTCCCCATCACCATCAAGTTCAAGAGCATGCTGCAGGCGGGCGTGCAGACGAAGGACATGGACCCGCGGTGG
ATGTCGAGCATCAGCTGGTACTTCCTCTGCATCTTTGGCCTGCAGTTTGTCTACGTCTTCCTGCTCGGCAGCGAC
AATGCCGCCAGTCAGATGGCCCAGCAGATGGCTGCGCAGCAGATGCCCATGGCCGGCATGGGCGGCCCCGGCCAG
GACCCGGACAAGCAGTTCAAGACCGAGGCCGAGAATCTCGCCGTCGTGGAGCACTACTCGGTTCTGGACGGCGTC
GAGGAACGTCTTCTCGAGGGTATCAGGTCATAG
Gene >Hirsu2|9899
ATGGCCCAAGTCCCGATTCAGACACTCCATCGGGATCCCCAGCTCTTGTGCGTGTGAAGAAAGAGGCGTCGTCGA
CGCCGGTTTCCCTGCCGCGGTCTGCGCACCGCGATACTGATTTGCTGACTGCGCGGCGGCTCACAGCTACTGGAT
CCTGATCCCCATCACCATCGTCATGGTCCTGACGGGCGTCCTGCGCCACTACGCCTCGGTCCTCATGGCCACGGC
GCCCAAGCGGCTGGACACGCGGGCCATGCGCGAGCTGCGCGCCCTCGCCCGCGGCGTCGCCCTGCGCTCCAACTT
CCACGTCCTCTCCCGCCGCGCCTTCGAGACCCGCCGCGACGCCCTCGCCACCGGCTACGAGTCGGGCGCCTTCCT
CAAGGAGCCCGAGCGCAAGGGCCAGCCGCCCGCCAACCCGCTGACCGACCCGAGTCAGATGGACGGCATGATGGG
CATGATGAAGAACAACATGGCCATGATCATCCCCAACACACTCATCATGAGCTGGATCAACGCCTTCTTCAGCGG
CTACGTCATCAGTGCGTCCTCCCCCGTCGTTCTCCTCTGGGGCACGCCCCGTCTGGGCGTACCACGCGGCATTGG
CTAAGCCGAGACGCGTTGCTAGTGAAATTGCCGTTCCCCATCACCATCAAGTTCAAGAGCATGCTGCAGGCGGGC
GTGCAGACGAAGGACATGGACCCGCGGTGGATGTCGAGCATCAGCTGGTACTTCCTCTGCATCTTTGGCCTGCAG
TTTGTCTACGTCTTCCTGCTCGGCAGCGACAATGGTAAGGCTTCTCCGCCCCGCCCCGCGGTCCGCGCCTCGTGC
TGACCGGACCGCAGCCGCCAGTCAGATGGCCCAGCAGATGGCTGCGCAGCAGATGCCCATGGCCGGCATGGGCGG
CCCCGGCCAGGACCCGGACAAGCAGTTCAAGACCGAGGCCGAGAATCTCGCCGTCGTGGAGCACTACTCGGTTCT
GGACGGCGTCGAGGAACGTCTTCTCGAGGGTATCAGGTCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail