Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|989
Gene name
LocationContig_1203:6637..8014
Strand+
Gene length (bp)1377
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12588 PSDC Phophatidylserine decarboxylase 2.6E-53 51 189
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 3.5E-28 226 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 221 429 2.0E-18
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 222 431 5.0E-15
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 222 425 2.0E-13
sp|Q8RGF2|PSD_FUSNN Phosphatidylserine decarboxylase proenzyme OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=psd PE=3 SV=1 222 428 1.0E-12
sp|A8MJ83|PSD_ALKOO Phosphatidylserine decarboxylase proenzyme OS=Alkaliphilus oremlandii (strain OhILAs) GN=psd PE=3 SV=1 216 428 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 221 429 2.0E-18
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 222 431 5.0E-15
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 222 425 2.0E-13
sp|Q8RGF2|PSD_FUSNN Phosphatidylserine decarboxylase proenzyme OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=psd PE=3 SV=1 222 428 1.0E-12
sp|A8MJ83|PSD_ALKOO Phosphatidylserine decarboxylase proenzyme OS=Alkaliphilus oremlandii (strain OhILAs) GN=psd PE=3 SV=1 216 428 9.0E-12
sp|Q256C9|PSD_CHLFF Phosphatidylserine decarboxylase proenzyme OS=Chlamydophila felis (strain Fe/C-56) GN=psd PE=3 SV=1 211 428 1.0E-10
sp|A9VHW5|PSD_BACWK Phosphatidylserine decarboxylase proenzyme OS=Bacillus weihenstephanensis (strain KBAB4) GN=psd PE=3 SV=1 204 440 1.0E-10
sp|P0CD79|PSD_CHLTR Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=psd PE=3 SV=1 211 427 1.0E-10
sp|Q3KKZ5|PSD_CHLTA Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=psd PE=3 SV=1 211 427 1.0E-10
sp|B0B8S5|PSD_CHLT2 Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=psd PE=3 SV=1 211 427 1.0E-10
sp|B0BAF4|PSD_CHLTB Phosphatidylserine decarboxylase proenzyme OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=psd PE=3 SV=1 211 427 1.0E-10
sp|Q5JN42|PSD2_ORYSJ Phosphatidylserine decarboxylase proenzyme 2 OS=Oryza sativa subsp. japonica GN=PSD2 PE=3 SV=2 198 425 4.0E-10
sp|A0Q3R9|PSD_CLONN Phosphatidylserine decarboxylase proenzyme OS=Clostridium novyi (strain NT) GN=psd PE=3 SV=1 222 427 5.0E-10
sp|Q821L3|PSD_CHLCV Phosphatidylserine decarboxylase proenzyme OS=Chlamydophila caviae (strain GPIC) GN=psd PE=3 SV=1 211 429 7.0E-10
sp|Q5L4W1|PSD_CHLAB Phosphatidylserine decarboxylase proenzyme OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=psd PE=3 SV=1 222 428 2.0E-09
sp|Q9PLM7|PSD_CHLMU Phosphatidylserine decarboxylase proenzyme OS=Chlamydia muridarum (strain MoPn / Nigg) GN=psd PE=3 SV=1 211 427 3.0E-09
sp|Q818C6|PSD_BACCR Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=psd PE=3 SV=1 222 425 3.0E-09
sp|B7HCW5|PSD_BACC4 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain B4264) GN=psd PE=3 SV=1 222 425 3.0E-09
sp|B7IYJ1|PSD_BACC2 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain G9842) GN=psd PE=3 SV=1 222 440 4.0E-09
sp|A7GT32|PSD_BACCN Phosphatidylserine decarboxylase proenzyme OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=psd PE=3 SV=1 266 429 6.0E-09
sp|Q634K5|PSD_BACCZ Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ZK / E33L) GN=psd PE=3 SV=1 222 440 6.0E-09
sp|Q0TV39|PSD_CLOP1 Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=psd PE=3 SV=1 222 426 6.0E-09
sp|C3P929|PSD_BACAA Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain A0248) GN=psd PE=3 SV=1 222 440 7.0E-09
sp|C3L5U2|PSD_BACAC Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=psd PE=3 SV=1 222 440 7.0E-09
sp|Q81LP7|PSD_BACAN Phosphatidylserine decarboxylase proenzyme OS=Bacillus anthracis GN=psd PE=3 SV=1 222 440 7.0E-09
sp|B7JNX0|PSD_BACC0 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH820) GN=psd PE=3 SV=1 222 440 7.0E-09
sp|B7HPN7|PSD_BACC7 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain AH187) GN=psd PE=3 SV=1 222 440 7.0E-09
sp|Q0SWT6|PSD_CLOPS Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain SM101 / Type A) GN=psd PE=3 SV=1 222 426 7.0E-09
sp|Q8XPD5|PSD_CLOPE Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain 13 / Type A) GN=psd PE=3 SV=1 222 426 1.0E-08
sp|C1ESN2|PSD_BACC3 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain 03BB102) GN=psd PE=3 SV=1 266 425 1.0E-08
sp|A0RIV4|PSD_BACAH Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis (strain Al Hakam) GN=psd PE=3 SV=1 266 425 1.0E-08
sp|Q6HDI5|PSD_BACHK Phosphatidylserine decarboxylase proenzyme OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=psd PE=3 SV=1 266 425 1.0E-08
sp|B8I6U9|PSD_CLOCE Phosphatidylserine decarboxylase proenzyme OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=psd PE=3 SV=1 205 429 2.0E-08
sp|Q0VMD7|PSD_ALCBS Phosphatidylserine decarboxylase proenzyme OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=psd PE=3 SV=1 222 452 2.0E-08
sp|Q730J7|PSD_BACC1 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=psd PE=3 SV=2 222 440 2.0E-08
sp|A4VR22|PSD_PSEU5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 218 427 4.0E-08
sp|B7GKA2|PSD_ANOFW Phosphatidylserine decarboxylase proenzyme OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=psd PE=3 SV=1 222 429 4.0E-08
sp|Q21H90|PSD_SACD2 Phosphatidylserine decarboxylase proenzyme OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=psd PE=3 SV=1 214 428 1.0E-07
sp|Q4FQD5|PSD_PSYA2 Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=psd PE=3 SV=1 221 424 3.0E-07
sp|A3MA23|PSD_ACIBT Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=psd PE=3 SV=2 222 425 3.0E-07
sp|Q46192|PSD_CLOPA Phosphatidylserine decarboxylase proenzyme OS=Clostridium pasteurianum GN=psd PE=3 SV=1 222 425 3.0E-07
sp|B7GUX2|PSD_ACIB3 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB307-0294) GN=psd PE=3 SV=1 222 425 3.0E-07
sp|B7I242|PSD_ACIB5 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB0057) GN=psd PE=3 SV=1 222 425 3.0E-07
sp|B0V9W1|PSD_ACIBY Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AYE) GN=psd PE=3 SV=1 222 425 3.0E-07
sp|B0TU73|PSD_SHEHH Phosphatidylserine decarboxylase proenzyme OS=Shewanella halifaxensis (strain HAW-EB4) GN=psd PE=3 SV=1 187 425 4.0E-07
sp|B2I1N9|PSD_ACIBC Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ACICU) GN=psd PE=3 SV=1 222 425 4.0E-07
sp|Q6F6W3|PSD_ACIAD Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=psd PE=3 SV=1 222 425 4.0E-07
sp|Q1Q8K8|PSD_PSYCK Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter cryohalolentis (strain K5) GN=psd PE=3 SV=1 221 424 1.0E-06
sp|Q1D614|PSD_MYXXD Phosphatidylserine decarboxylase proenzyme OS=Myxococcus xanthus (strain DK 1622) GN=psd PE=3 SV=1 205 427 1.0E-06
sp|B9MAC0|PSD_ACIET Phosphatidylserine decarboxylase proenzyme OS=Acidovorax ebreus (strain TPSY) GN=psd PE=3 SV=1 216 425 2.0E-06
sp|A4G529|PSD_HERAR Phosphatidylserine decarboxylase proenzyme OS=Herminiimonas arsenicoxydans GN=psd PE=3 SV=1 216 425 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004609 phosphatidylserine decarboxylase activity Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0003824 catalytic activity No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0016831 carboxy-lyase activity No
GO:0019637 organophosphate metabolic process No
GO:0008152 metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0090407 organophosphate biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0016829 lyase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.566 0.4856 0.0581 0.1139 0.0999 0.0112 0.2763 0.1636 0.2214 0.0038

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup309
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2710
Ophiocordyceps australis map64 (Brazil) OphauB2|5632
Ophiocordyceps australis map64 (Brazil) OphauB2|5656
Ophiocordyceps camponoti-floridani Ophcf2|00043
Ophiocordyceps camponoti-rufipedis Ophun1|6281
Ophiocordyceps kimflemingae Ophio5|2558
Ophiocordyceps subramaniannii Hirsu2|1125
Ophiocordyceps subramaniannii Hirsu2|3028
Ophiocordyceps subramaniannii Hirsu2|3864
Ophiocordyceps subramaniannii Hirsu2|989 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|989
MSSTGATPQRHHGFNRIGGWLPQNPDLLVDWLRKLVAELDGRRKRAPLTRQVQELKELIESTAELRMLASAMFDE
VPEKEPYNEDPIGNKQVRSYQHMLELFNVVMTEKAPIWSEQEYGVGLIGFPFNAILDWPMGTASGYAFFLKAEVN
AKFKAILDGWRDDFLTTERSRQVINDGEDGWLSSESLATIERDTNVGTGQDWMTFQELFECDPEGDPEHWGFKSW
DDFFVRRFRNFDTIRPVAYPDRPEWIVSSCESKPFALQTNVRDYDSFWLKGQPYSVLEVMGHDERAGQFVGGTVY
QAFLSATSYHRWNAPVGGKVVASRVIDGTYFSEPTVTGFTHPDGPDPAAPDRAQGYITHVATRALFYIQAPEPVG
LMAVVFVGMADVSTCQILPDFAPSKLPADVRKGDELGMFHHGGSTHCLLFRPGVKLAFVAEASPGAHDKNIPVRG
ELAYAYQG*
Coding >Hirsu2|989
ATGTCGAGCACCGGGGCGACTCCTCAGCGGCACCATGGCTTCAACCGGATCGGCGGTTGGCTGCCGCAGAATCCG
GATTTGCTGGTCGACTGGCTTCGAAAACTGGTGGCCGAGCTGGATGGCAGGAGGAAGCGAGCCCCCCTGACGCGA
CAGGTGCAGGAGCTGAAGGAGTTGATCGAGAGCACGGCCGAGCTTCGGATGCTCGCGTCGGCCATGTTCGACGAG
GTGCCGGAGAAGGAGCCGTACAACGAGGATCCGATCGGCAACAAGCAGGTGCGAAGCTACCAGCACATGCTGGAG
CTCTTCAACGTTGTCATGACGGAGAAGGCGCCGATCTGGAGCGAGCAGGAGTACGGCGTCGGCCTGATCGGCTTC
CCCTTCAACGCCATCCTGGACTGGCCCATGGGCACCGCCAGCGGCTACGCCTTCTTCCTCAAGGCCGAGGTCAAC
GCCAAGTTCAAGGCGATCCTGGACGGCTGGCGGGACGACTTCCTGACGACGGAGAGGTCGCGGCAGGTCATCAAC
GACGGCGAGGACGGCTGGCTCAGCAGCGAGTCGCTGGCGACCATCGAGCGGGACACCAACGTCGGCACCGGCCAG
GACTGGATGACCTTCCAGGAGCTCTTCGAGTGCGACCCGGAGGGCGACCCGGAGCACTGGGGCTTCAAGTCGTGG
GACGACTTCTTCGTCCGCCGCTTCCGCAACTTCGACACGATCCGCCCGGTCGCGTACCCGGACCGGCCGGAGTGG
ATCGTCAGCTCGTGCGAGTCGAAGCCGTTCGCGCTGCAGACCAACGTGCGCGACTACGACAGCTTCTGGCTCAAG
GGCCAGCCCTACTCGGTCCTCGAGGTGATGGGCCACGACGAGCGCGCCGGCCAGTTCGTCGGCGGCACCGTCTAC
CAGGCCTTCCTCAGCGCCACCTCGTACCACCGGTGGAACGCGCCGGTCGGCGGCAAGGTCGTCGCCAGCCGCGTC
ATCGACGGCACCTACTTCTCCGAGCCGACCGTCACCGGCTTCACCCACCCGGACGGGCCGGACCCGGCGGCGCCG
GACCGCGCGCAGGGCTACATCACCCACGTCGCCACGCGCGCCCTCTTCTACATCCAGGCCCCGGAGCCGGTCGGC
CTGATGGCCGTCGTCTTCGTCGGCATGGCCGACGTGTCCACCTGCCAGATCCTGCCCGACTTCGCCCCCAGCAAG
CTGCCGGCCGACGTCCGCAAGGGCGACGAGCTGGGCATGTTCCACCACGGCGGCTCGACGCACTGCCTGCTCTTC
CGCCCGGGCGTCAAGCTCGCCTTCGTCGCCGAAGCGTCGCCCGGCGCCCACGACAAGAACATCCCGGTCCGAGGC
GAGCTGGCGTACGCGTACCAGGGCTGA
Transcript >Hirsu2|989
ATGTCGAGCACCGGGGCGACTCCTCAGCGGCACCATGGCTTCAACCGGATCGGCGGTTGGCTGCCGCAGAATCCG
GATTTGCTGGTCGACTGGCTTCGAAAACTGGTGGCCGAGCTGGATGGCAGGAGGAAGCGAGCCCCCCTGACGCGA
CAGGTGCAGGAGCTGAAGGAGTTGATCGAGAGCACGGCCGAGCTTCGGATGCTCGCGTCGGCCATGTTCGACGAG
GTGCCGGAGAAGGAGCCGTACAACGAGGATCCGATCGGCAACAAGCAGGTGCGAAGCTACCAGCACATGCTGGAG
CTCTTCAACGTTGTCATGACGGAGAAGGCGCCGATCTGGAGCGAGCAGGAGTACGGCGTCGGCCTGATCGGCTTC
CCCTTCAACGCCATCCTGGACTGGCCCATGGGCACCGCCAGCGGCTACGCCTTCTTCCTCAAGGCCGAGGTCAAC
GCCAAGTTCAAGGCGATCCTGGACGGCTGGCGGGACGACTTCCTGACGACGGAGAGGTCGCGGCAGGTCATCAAC
GACGGCGAGGACGGCTGGCTCAGCAGCGAGTCGCTGGCGACCATCGAGCGGGACACCAACGTCGGCACCGGCCAG
GACTGGATGACCTTCCAGGAGCTCTTCGAGTGCGACCCGGAGGGCGACCCGGAGCACTGGGGCTTCAAGTCGTGG
GACGACTTCTTCGTCCGCCGCTTCCGCAACTTCGACACGATCCGCCCGGTCGCGTACCCGGACCGGCCGGAGTGG
ATCGTCAGCTCGTGCGAGTCGAAGCCGTTCGCGCTGCAGACCAACGTGCGCGACTACGACAGCTTCTGGCTCAAG
GGCCAGCCCTACTCGGTCCTCGAGGTGATGGGCCACGACGAGCGCGCCGGCCAGTTCGTCGGCGGCACCGTCTAC
CAGGCCTTCCTCAGCGCCACCTCGTACCACCGGTGGAACGCGCCGGTCGGCGGCAAGGTCGTCGCCAGCCGCGTC
ATCGACGGCACCTACTTCTCCGAGCCGACCGTCACCGGCTTCACCCACCCGGACGGGCCGGACCCGGCGGCGCCG
GACCGCGCGCAGGGCTACATCACCCACGTCGCCACGCGCGCCCTCTTCTACATCCAGGCCCCGGAGCCGGTCGGC
CTGATGGCCGTCGTCTTCGTCGGCATGGCCGACGTGTCCACCTGCCAGATCCTGCCCGACTTCGCCCCCAGCAAG
CTGCCGGCCGACGTCCGCAAGGGCGACGAGCTGGGCATGTTCCACCACGGCGGCTCGACGCACTGCCTGCTCTTC
CGCCCGGGCGTCAAGCTCGCCTTCGTCGCCGAAGCGTCGCCCGGCGCCCACGACAAGAACATCCCGGTCCGAGGC
GAGCTGGCGTACGCGTACCAGGGCTGA
Gene >Hirsu2|989
ATGTCGAGCACCGGGGCGACTCCTCAGCGGCACCATGGCTTCAACCGGATCGGCGGTTGGCTGCCGCAGAATCCG
GATTTGCTGGTCGACTGGCTTCGAAAACTGGTGGCCGAGCTGGATGGCAGGAGGAAGCGAGCCCCCCTGACGCGA
CAGGTGCAGGAGCTGAAGGAGTTGATCGAGAGCACGGCCGAGCTTCGGATGCTCGCGTCGGCCATGTTCGACGAG
GTGCCGGAGAAGGAGCCGTACAACGAGGATCCGATCGGCAACAAGCAGGTGCGAAGCTACCAGCACATGCTGGAG
CTCTTCAACGTTGTCATGACGGAGAAGGCGCCGATCTGGAGCGAGCAGGAGTACGGCGTCGGCCTGATCGGCTTC
CCCTTCAACGCCATCCTGGACTGGCCCATGGGCACCGCCAGCGGCTACGCCTTCTTCCTCAAGGCCGAGGTCAAC
GCCAAGTTCAAGGCGATCCTGGACGGCTGGCGGGACGACTTCCTGACGACGGAGAGGTCGCGGCAGGTCATCAAC
GACGGCGAGGACGGCTGGCTCAGCAGCGAGTCGCTGGCGACCATCGAGCGGGACACCAACGTCGGCACCGGCCAG
GACTGGATGACCTTCCAGGAGCTCTTCGAGTGCGACCCGGAGGGCGACCCGGAGCACTGGGGCTTCAAGTCGTGG
GACGACTTCTTCGTCCGCCGCTTCCGCAACTTCGACACGATCCGCCCGGTCGCGTACCCGGACCGGCCGGAGTGG
ATCGTCAGCTCGTGCGAGTCGAAGCCGTTCGCGCTGCAGACCAACGTGCGCGACTACGACAGCTTCTGGCTCAAG
GGCCAGCCCTACTCGGTCCTCGAGGTGATGGGCCACGACGAGCGCGCCGGCCAGTTCGTCGGCGGCACCGTCTAC
CAGGCCTTCCTCAGCGCCACCTCGTACCACCGGTGGAACGCGCCGGTCGGCGGCAAGGTCGTCGCCAGCCGCGTC
ATCGACGGCACCTACTTCTCCGAGCCGACCGTCACCGGCTTCACCCACCCGGACGGGCCGGACCCGGCGGCGCCG
GACCGCGCGCAGGGCTACATCACCCACGTCGCCACGCGCGCCCTCTTCTACATCCAGGCCCCGGAGCCGGTCGGC
CTGATGGCCGTCGTCTTCGTCGGCATGGCCGACGTGTCCACCTGCCAGATCCTGCCCGACTTCGCCCCCAGCAAG
CTGCCGGCCGACGTCCGCAAGGGCGACGAGCTGGGCATGTTCCACCACGGCGGCTCGACGCACTGCCTGCTCTTC
CGCCCGGGCGTCAAGCTCGCCTTCGTCGCCGAAGCGTCGCCCGGCGCCCACGACAAGAACATCCCGGTCCGAGGC
GAGCTGGCGTACGCGTACCAGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail