Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9888
Gene name
LocationContig_754:711..3301
Strand-
Gene length (bp)2590
Transcript length (bp)2463
Coding sequence length (bp)2463
Protein length (aa) 821

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 2.9E-12 683 727
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.7E-09 683 726
PF12678 zf-rbx1 RING-H2 zinc finger domain 1.2E-08 684 727
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.2E-08 684 726
PF02225 PA PA domain 2.9E-08 201 280
PF17123 zf-RING_11 RING-like zinc finger 1.9E-08 683 712
PF14634 zf-RING_5 zinc-RING finger domain 1.2E-06 683 727
PF13445 zf-RING_UBOX RING-type zinc-finger 4.0E-05 684 724

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 684 733 6.0E-11
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 684 733 7.0E-11
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 684 757 1.0E-10
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 684 733 2.0E-10
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 684 733 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 684 733 6.0E-11
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 684 733 7.0E-11
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 684 757 1.0E-10
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 684 733 2.0E-10
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 684 733 2.0E-10
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 684 733 2.0E-10
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 684 732 4.0E-10
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 684 732 4.0E-10
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 684 732 5.0E-10
sp|P87139|YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.09 PE=1 SV=1 682 730 4.0E-09
sp|O64763|ATL9_ARATH E3 ubiquitin-protein ligase ATL9 OS=Arabidopsis thaliana GN=ATL9 PE=1 SV=1 682 780 6.0E-09
sp|O00237|RN103_HUMAN E3 ubiquitin-protein ligase RNF103 OS=Homo sapiens GN=RNF103 PE=1 SV=1 678 727 7.0E-09
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 656 729 8.0E-09
sp|Q9EPZ8|RN103_RAT E3 ubiquitin-protein ligase RNF103 OS=Rattus norvegicus GN=Rnf103 PE=2 SV=1 683 727 1.0E-08
sp|Q9R1W3|RN103_MOUSE E3 ubiquitin-protein ligase RNF103 OS=Mus musculus GN=Rnf103 PE=2 SV=2 683 727 1.0E-08
sp|Q9ZQF9|MBR1_ARATH E3 ubiquitin-protein ligase MBR1 OS=Arabidopsis thaliana GN=MBR1 PE=1 SV=1 684 733 1.0E-08
sp|Q7XTV7|HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica GN=HIP1 PE=1 SV=2 672 733 2.0E-08
sp|Q9M0R7|ATL39_ARATH RING-H2 finger protein ATL39 OS=Arabidopsis thaliana GN=ATL39 PE=2 SV=1 681 731 2.0E-08
sp|Q8VZ14|RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana GN=RMR2 PE=2 SV=1 684 729 4.0E-08
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 675 727 4.0E-08
sp|Q10R93|RMR1_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0167500 PE=2 SV=1 660 729 6.0E-08
sp|Q6IRP0|R126B_XENLA E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 675 727 6.0E-08
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 656 729 7.0E-08
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 656 729 7.0E-08
sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 684 732 7.0E-08
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 656 729 8.0E-08
sp|Q8GUU2|RIE1_ARATH E3 ubiquitin protein ligase RIE1 OS=Arabidopsis thaliana GN=RIE1 PE=2 SV=1 675 732 8.0E-08
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 684 733 8.0E-08
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 684 742 9.0E-08
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 684 733 1.0E-07
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 684 738 1.0E-07
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 682 756 1.0E-07
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 684 734 1.0E-07
sp|Q7T0Q3|R126A_XENLA E3 ubiquitin-protein ligase RNF126-A OS=Xenopus laevis GN=rnf126-a PE=2 SV=1 675 727 1.0E-07
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 683 738 1.0E-07
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 683 745 1.0E-07
sp|Q4R6Y5|ZNRF4_MACFA Zinc/RING finger protein 4 OS=Macaca fascicularis GN=ZNRF4 PE=2 SV=1 672 730 1.0E-07
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 656 729 2.0E-07
sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 683 733 2.0E-07
sp|Q8RXD3|AIP2_ARATH E3 ubiquitin-protein ligase AIP2 OS=Arabidopsis thaliana GN=AIP2 PE=1 SV=1 670 730 2.0E-07
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 684 729 2.0E-07
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 683 733 2.0E-07
sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 684 734 2.0E-07
sp|Q9BZQ6|EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens GN=EDEM3 PE=1 SV=2 105 319 3.0E-07
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 682 729 4.0E-07
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 656 729 4.0E-07
sp|Q2HXL6|EDEM3_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus GN=Edem3 PE=1 SV=2 105 337 5.0E-07
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 679 732 5.0E-07
sp|Q8WWF5|ZNRF4_HUMAN Zinc/RING finger protein 4 OS=Homo sapiens GN=ZNRF4 PE=2 SV=3 672 730 6.0E-07
sp|Q9M0R6|ATL35_ARATH Putative RING-H2 finger protein ATL35 OS=Arabidopsis thaliana GN=ATL35 PE=3 SV=1 682 730 7.0E-07
sp|P87119|MU145_SCHPO RING finger protein mug145 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug145 PE=1 SV=1 684 736 7.0E-07
sp|P0C035|ATL60_ARATH RING-H2 finger protein ATL60 OS=Arabidopsis thaliana GN=ATL60 PE=2 SV=1 682 750 8.0E-07
sp|A5WWA0|ZNRF3_DANRE E3 ubiquitin-protein ligase ZNRF3 OS=Danio rerio GN=znrf3 PE=1 SV=2 684 731 8.0E-07
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 684 730 8.0E-07
sp|Q9LUL6|ATL61_ARATH Putative RING-H2 finger protein ATL61 OS=Arabidopsis thaliana GN=ATL61 PE=3 SV=1 682 756 9.0E-07
sp|Q8GXF8|SHGR9_ARATH E3 ubiquitin-protein ligase SGR9, amyloplastic OS=Arabidopsis thaliana GN=SGR9 PE=1 SV=1 681 727 1.0E-06
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 684 731 1.0E-06
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 675 727 1.0E-06
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 683 738 1.0E-06
sp|Q5RF74|RN128_PONAB E3 ubiquitin-protein ligase RNF128 OS=Pongo abelii GN=RNF128 PE=2 SV=1 660 734 1.0E-06
sp|Q29RU0|RN128_BOVIN E3 ubiquitin-protein ligase RNF128 OS=Bos taurus GN=RNF128 PE=2 SV=1 660 734 1.0E-06
sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 673 727 2.0E-06
sp|Q08D68|ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis GN=znrf3 PE=1 SV=1 684 731 2.0E-06
sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens GN=RNF126 PE=1 SV=1 675 727 2.0E-06
sp|Q9M0R4|ATL37_ARATH Putative RING-H2 finger protein ATL37 OS=Arabidopsis thaliana GN=ATL37 PE=3 SV=1 682 730 2.0E-06
sp|Q6GQB9|EDEM3_XENLA ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis GN=edem3 PE=2 SV=2 132 299 3.0E-06
sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 683 733 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 547 569 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9888
MRPPRIAVLALFIAVSVFILGRAFTSASRPHASAYTAEARTTRSVFGFMYYNTPFSLFPPNAAISLTDDNSTSFA
ARPAAFGPKLVTNGLSGQLWVGSGFVEDSQDGDGELGCSDLPGWGSGNTRAALRNSFRAELPRNSPSQPGSAHHP
KRAGQLLDPDHREAIPRVRARSGPVDDARHPDDRRTAASARRDGSSSSSTHADIQSIQEAAEIQGKVVLLTRGGC
GFLEKVMWAQRRGAIAVIVGDDQRGGPLIQMFAHGDEVYNVTVPSVFTARTTAQLLSSLTQPGSFIEDTLDDNGN
PVRKVQQGPKGRQDASKRTLSPGVAATASSGAATPKSRARRAVKDHADDAAPRGSSGRRSWLSWLFGWRQLPLAM
DAESRPPSSGRLDWVLVDGWSEERDKVLRESLRKRKPKPDDDGFVIGRDDWRRHGPAALPNKAAEDSSREGSKAK
TAAKEADGPKGGSTTPGSGEYSPSSKDGKGHGLVSKLFSSDEKKGESTAVGDGSGDRNGRDGDGSQPPPDRHRDF
GPHEGLWVTITPTSSASPFFDTLLVLVISPLVTLTVVYALLIVRARIRRRRWRAPKSVVDRLPVRTYHTAAASPS
LSPRLPSPSGATPTTPLLQHSPTRPRPRSRTTTGVLQSENFLVPSPAVPTPQPSTRGGTRAEHEKGFGGFSAEWR
KYMGRQVECVVCLEEYVDGVSRVMSLPCGHEFHADCITPWLTTRRRTCPICKGDVVRSLARGGCDGPRYEPYHDG
SDNEAEVEASGSRSEGGPSDPEQGILSPSSRGREPPQSGRQEGWLGLLSGSFGARTRPRSQTPQPQSRSR*
Coding >Hirsu2|9888
ATGCGGCCGCCGCGCATCGCCGTCCTCGCCCTCTTCATCGCCGTCTCCGTCTTCATCCTCGGCCGCGCCTTCACC
TCGGCCAGCCGCCCGCATGCCTCCGCCTACACCGCCGAAGCCCGCACCACGCGGTCCGTCTTTGGCTTCATGTAC
TACAACACGCCCTTCTCGCTCTTTCCTCCCAACGCCGCCATCAGCTTGACCGACGACAACAGCACCTCCTTCGCC
GCCCGCCCCGCCGCCTTCGGCCCCAAGCTCGTGACCAACGGCCTCAGCGGCCAGCTCTGGGTCGGCAGCGGCTTC
GTCGAGGACAGCCAGGACGGCGACGGCGAGCTGGGCTGCAGCGACCTCCCCGGCTGGGGCAGCGGCAACACCAGG
GCCGCCCTCCGGAACTCGTTCCGCGCCGAGCTCCCCCGAAACTCTCCGTCCCAGCCCGGCTCCGCCCACCATCCG
AAGCGCGCCGGCCAGCTGCTCGACCCCGACCACCGCGAAGCCATCCCCAGAGTCCGAGCCCGATCCGGCCCCGTC
GACGACGCCCGACACCCCGATGACCGCCGCACCGCCGCCTCCGCCCGCCGCGACGGCTCCTCCTCCTCCTCCACC
CACGCCGACATACAGTCCATCCAAGAGGCCGCCGAGATACAGGGCAAGGTTGTCCTGCTCACCCGCGGCGGCTGC
GGCTTCCTGGAAAAGGTCATGTGGGCCCAGCGCCGGGGCGCCATTGCCGTCATCGTCGGCGACGACCAGAGAGGC
GGCCCGCTGATCCAGATGTTCGCCCACGGCGACGAGGTCTACAACGTGACGGTGCCGTCCGTCTTCACCGCCCGC
ACCACGGCCCAGCTGCTGTCGTCCCTGACGCAGCCCGGCAGCTTCATCGAGGACACGCTCGACGACAACGGGAAC
CCCGTGCGCAAGGTCCAGCAGGGCCCCAAGGGGAGGCAGGACGCCAGCAAGCGCACCTTGAGCCCCGGCGTCGCC
GCCACGGCCTCGTCCGGCGCTGCCACGCCCAAGTCGAGGGCGCGCCGCGCCGTCAAGGACCACGCCGACGATGCC
GCGCCGAGGGGCTCGTCGGGCAGGCGCAGTTGGCTGTCGTGGCTTTTCGGATGGCGTCAGCTGCCCCTGGCCATG
GACGCCGAGAGCCGGCCGCCGAGCAGCGGCCGACTGGATTGGGTCCTCGTCGACGGTTGGAGCGAGGAACGGGAC
AAGGTCTTGAGGGAGAGCCTGAGGAAACGCAAGCCCAAGCCGGACGACGACGGCTTCGTCATCGGCCGAGATGAC
TGGCGCAGGCACGGCCCCGCCGCACTGCCGAACAAGGCCGCCGAGGATTCCAGCCGCGAAGGCTCCAAGGCCAAG
ACGGCCGCCAAGGAGGCGGACGGTCCCAAGGGGGGGAGCACCACCCCGGGCAGCGGCGAGTACAGCCCGTCGTCC
AAGGACGGCAAGGGCCACGGCCTCGTCTCGAAGCTCTTCAGCAGCGACGAGAAGAAGGGTGAATCTACCGCCGTC
GGAGACGGCTCCGGCGACAGGAACGGCCGCGACGGCGACGGCTCTCAGCCTCCCCCGGACCGGCACCGCGACTTC
GGGCCGCACGAGGGACTGTGGGTCACAATCACGCCGACCAGCAGCGCCAGCCCCTTCTTCGACACCCTCCTGGTG
CTCGTCATCAGCCCGCTCGTCACGCTGACGGTGGTGTACGCGCTCTTGATCGTGCGCGCCAGGATCCGCAGGAGG
AGGTGGAGGGCGCCCAAGTCGGTCGTCGACCGCCTGCCCGTGCGGACCTACCACACGGCGGCCGCGTCTCCCAGC
CTGTCGCCGAGGCTGCCGTCCCCCTCGGGCGCGACCCCCACCACGCCTCTGCTGCAGCACAGCCCAACGAGGCCG
AGGCCGCGCTCGAGGACGACGACGGGCGTCCTGCAGAGCGAGAATTTTTTGGTGCCGAGCCCCGCCGTGCCGACG
CCGCAGCCGTCGACGCGCGGCGGCACGCGCGCCGAGCACGAAAAGGGCTTCGGCGGCTTCTCCGCCGAGTGGAGG
AAGTACATGGGCCGGCAGGTCGAGTGCGTCGTGTGCCTGGAGGAGTACGTCGACGGCGTGAGCAGGGTGATGAGC
TTGCCCTGCGGCCACGAGTTCCACGCCGATTGCATAACTCCTTGGTTGACGACGCGCCGACGAACGTGCCCCATC
TGCAAGGGAGACGTGGTCCGGTCTCTGGCCCGCGGCGGCTGCGACGGCCCCCGGTACGAGCCCTACCACGACGGC
AGCGACAACGAGGCCGAGGTCGAGGCCTCGGGCTCGCGGTCGGAGGGGGGCCCCTCGGACCCGGAACAGGGCATC
CTGTCGCCCAGCAGCCGGGGCCGGGAGCCGCCGCAGTCCGGCCGGCAGGAAGGGTGGCTCGGCCTGCTGTCGGGC
AGCTTCGGCGCGCGGACCCGGCCGCGGTCGCAGACGCCGCAGCCCCAAAGCCGCAGCCGGTGA
Transcript >Hirsu2|9888
ATGCGGCCGCCGCGCATCGCCGTCCTCGCCCTCTTCATCGCCGTCTCCGTCTTCATCCTCGGCCGCGCCTTCACC
TCGGCCAGCCGCCCGCATGCCTCCGCCTACACCGCCGAAGCCCGCACCACGCGGTCCGTCTTTGGCTTCATGTAC
TACAACACGCCCTTCTCGCTCTTTCCTCCCAACGCCGCCATCAGCTTGACCGACGACAACAGCACCTCCTTCGCC
GCCCGCCCCGCCGCCTTCGGCCCCAAGCTCGTGACCAACGGCCTCAGCGGCCAGCTCTGGGTCGGCAGCGGCTTC
GTCGAGGACAGCCAGGACGGCGACGGCGAGCTGGGCTGCAGCGACCTCCCCGGCTGGGGCAGCGGCAACACCAGG
GCCGCCCTCCGGAACTCGTTCCGCGCCGAGCTCCCCCGAAACTCTCCGTCCCAGCCCGGCTCCGCCCACCATCCG
AAGCGCGCCGGCCAGCTGCTCGACCCCGACCACCGCGAAGCCATCCCCAGAGTCCGAGCCCGATCCGGCCCCGTC
GACGACGCCCGACACCCCGATGACCGCCGCACCGCCGCCTCCGCCCGCCGCGACGGCTCCTCCTCCTCCTCCACC
CACGCCGACATACAGTCCATCCAAGAGGCCGCCGAGATACAGGGCAAGGTTGTCCTGCTCACCCGCGGCGGCTGC
GGCTTCCTGGAAAAGGTCATGTGGGCCCAGCGCCGGGGCGCCATTGCCGTCATCGTCGGCGACGACCAGAGAGGC
GGCCCGCTGATCCAGATGTTCGCCCACGGCGACGAGGTCTACAACGTGACGGTGCCGTCCGTCTTCACCGCCCGC
ACCACGGCCCAGCTGCTGTCGTCCCTGACGCAGCCCGGCAGCTTCATCGAGGACACGCTCGACGACAACGGGAAC
CCCGTGCGCAAGGTCCAGCAGGGCCCCAAGGGGAGGCAGGACGCCAGCAAGCGCACCTTGAGCCCCGGCGTCGCC
GCCACGGCCTCGTCCGGCGCTGCCACGCCCAAGTCGAGGGCGCGCCGCGCCGTCAAGGACCACGCCGACGATGCC
GCGCCGAGGGGCTCGTCGGGCAGGCGCAGTTGGCTGTCGTGGCTTTTCGGATGGCGTCAGCTGCCCCTGGCCATG
GACGCCGAGAGCCGGCCGCCGAGCAGCGGCCGACTGGATTGGGTCCTCGTCGACGGTTGGAGCGAGGAACGGGAC
AAGGTCTTGAGGGAGAGCCTGAGGAAACGCAAGCCCAAGCCGGACGACGACGGCTTCGTCATCGGCCGAGATGAC
TGGCGCAGGCACGGCCCCGCCGCACTGCCGAACAAGGCCGCCGAGGATTCCAGCCGCGAAGGCTCCAAGGCCAAG
ACGGCCGCCAAGGAGGCGGACGGTCCCAAGGGGGGGAGCACCACCCCGGGCAGCGGCGAGTACAGCCCGTCGTCC
AAGGACGGCAAGGGCCACGGCCTCGTCTCGAAGCTCTTCAGCAGCGACGAGAAGAAGGGTGAATCTACCGCCGTC
GGAGACGGCTCCGGCGACAGGAACGGCCGCGACGGCGACGGCTCTCAGCCTCCCCCGGACCGGCACCGCGACTTC
GGGCCGCACGAGGGACTGTGGGTCACAATCACGCCGACCAGCAGCGCCAGCCCCTTCTTCGACACCCTCCTGGTG
CTCGTCATCAGCCCGCTCGTCACGCTGACGGTGGTGTACGCGCTCTTGATCGTGCGCGCCAGGATCCGCAGGAGG
AGGTGGAGGGCGCCCAAGTCGGTCGTCGACCGCCTGCCCGTGCGGACCTACCACACGGCGGCCGCGTCTCCCAGC
CTGTCGCCGAGGCTGCCGTCCCCCTCGGGCGCGACCCCCACCACGCCTCTGCTGCAGCACAGCCCAACGAGGCCG
AGGCCGCGCTCGAGGACGACGACGGGCGTCCTGCAGAGCGAGAATTTTTTGGTGCCGAGCCCCGCCGTGCCGACG
CCGCAGCCGTCGACGCGCGGCGGCACGCGCGCCGAGCACGAAAAGGGCTTCGGCGGCTTCTCCGCCGAGTGGAGG
AAGTACATGGGCCGGCAGGTCGAGTGCGTCGTGTGCCTGGAGGAGTACGTCGACGGCGTGAGCAGGGTGATGAGC
TTGCCCTGCGGCCACGAGTTCCACGCCGATTGCATAACTCCTTGGTTGACGACGCGCCGACGAACGTGCCCCATC
TGCAAGGGAGACGTGGTCCGGTCTCTGGCCCGCGGCGGCTGCGACGGCCCCCGGTACGAGCCCTACCACGACGGC
AGCGACAACGAGGCCGAGGTCGAGGCCTCGGGCTCGCGGTCGGAGGGGGGCCCCTCGGACCCGGAACAGGGCATC
CTGTCGCCCAGCAGCCGGGGCCGGGAGCCGCCGCAGTCCGGCCGGCAGGAAGGGTGGCTCGGCCTGCTGTCGGGC
AGCTTCGGCGCGCGGACCCGGCCGCGGTCGCAGACGCCGCAGCCCCAAAGCCGCAGCCGGTGA
Gene >Hirsu2|9888
ATGCGGCCGCCGCGCATCGCCGTCCTCGCCCTCTTCATCGCCGTCTCCGTCTTCATCCTCGGCCGCGCCTTCACC
TCGGCCAGCCGCCCGCATGCCTCCGCCTACACCGCCGAAGCCCGCACCACGCGGTCCGTCTTTGGCTTCATGTAC
TACAACACGCCCTTCTCGCTCTTTCCTCCCAACGCCGCCATCAGCTTGACCGACGACAACAGCACCTCCTTCGCC
GCCCGCCCCGCCGCCTTCGGCCCCAAGCTCGTGACCAACGGCCTCAGCGGCCAGCTCTGGGTCGGCAGCGGCTTC
GTCGAGGACAGCCAGGACGGCGACGGCGAGCTGGGCTGCAGCGACCTCCCCGGCTGGGGCAGCGGCAACACCAGG
GCCGCCCTCCGGAACTCGTTCCGCGCCGAGCTCCCCCGAAACTCTCCGTCCCAGCCCGGCTCCGCCCACCATCCG
AAGCGCGCCGGCCAGCTGCTCGACCCCGACCACCGCGAAGCCATCCCCAGAGTCCGAGCCCGATCCGGCCCCGTC
GACGACGCCCGACACCCCGATGACCGCCGCACCGCCGCCTCCGCCCGCCGCGACGGCTCCTCCTCCTCCTCCACC
CACGCCGACATACAGTCCATCCAAGAGGCCGCCGAGATACAGGGCAAGGTTGTCCTGCTCACCCGCGGCGGCTGC
GGCTTCCTGGAAAAGGTCATGTGGGCCCAGCGCCGGGGCGCCATTGCCGTCATCGTCGGCGACGACCAGAGAGGC
GGCCCGCTGATCCAGATGTTCGCCCACGGCGACGAGGTCTACAACGTGACGGTGCCGTCCGTCTTCACCGCCCGC
ACCACGGCCCAGCTGCTGTCGTCCCTGACGCAGCCCGGCAGCTTCATCGAGGACACGCTCGACGACAACGGGAAC
CCCGTGCGCAAGGTCCAGCAGGGCCCCAAGGGGAGGCAGGACGCCAGCAAGCGCACCTTGAGCCCCGGCGTCGCC
GCCACGGCCTCGTCCGGCGCTGCCACGCCCAAGTCGAGGGCGCGCCGCGCCGTCAAGGACCACGCCGACGATGCC
GCGCCGAGGGGCTCGTCGGGCAGGCGCAGTTGGCTGTCGTGGCTTTTCGGATGGCGTCAGCTGCCCCTGGCCATG
GACGCCGAGAGCCGGCCGCCGAGCAGCGGCCGACTGGATTGGGTCCTCGTCGACGGTTGGAGCGAGGAACGGGAC
AAGGTCTTGAGGGAGAGCCTGAGGAAACGCAAGCCCAAGCCGGACGACGACGGCTTCGTCATCGGCCGAGATGAC
TGGCGCAGGCACGGCCCCGCCGCACTGCCGAACAAGGCCGCCGAGGATTCCAGCCGCGAAGGCTCCAAGGCCAAG
ACGGCCGCCAAGGAGGCGGACGGTCCCAAGGGGGGGAGCACCACCCCGGGCAGCGGCGAGTACAGCCCGTCGTCC
AAGGACGGCAAGGGCCACGGCCTCGTCTCGAAGCTCTTCAGCAGCGACGAGAAGAAGGGTGAATCTACCGCCGTC
GGAGACGGCTCCGGCGACAGGAACGGCCGCGACGGCGACGGCTCTCAGCCTCCCCCGGACCGGCACCGCGACTTC
GGGCCGCACGAGGGACTGTGGGTCACAATCACGCCGACCAGCAGCGCCAGCCCCTTCTTCGACACCCTCCTGGTG
CTCGTCATCAGCCCGCTCGTCACGCTGACGGTGGTGTACGCGCTCTTGATCGTGCGCGCCAGGATCCGCAGGAGG
AGGTGGAGGGCGCCCAAGTCGGTCGTCGACCGCCTGCCCGTGCGGACCTACCACACGGCGGCCGCGTCTCCCAGC
CTGTCGCCGAGGCTGCCGTCCCCCTCGGGCGCGACCCCCACCACGCCTCTGCTGCAGCACAGCCCAACGAGGCCG
AGGCCGCGCTCGAGGACGACGACGGGCGTCCTGCAGAGCGAGAATTTTTTGGTGCCGAGCCCCGCCGTGCCGACG
CCGCAGCCGTCGACGCGCGGCGGCACGCGCGCCGAGCACGAAAAGGGCTTCGGCGGCTTCTCCGCCGAGTGGAGG
AAGTACATGGGCCGGCAGGTCGAGTGCGTCGTGTGCCTGGAGGAGTACGTCGACGGCGTGAGCAGGGTGATGAGC
TTGCCCTGCGGCCACGAGTTCCACGCCGATTGCATGTGAGTCTTCTCATTTCCCTTCTCTCCCTCCGCTTCCTCT
GCGTCTTGCTCCCCCCAGCCTACAAGACAGACGCCGGCCCGTCCTTCTTTCGTCGGCGACGCACCCCCAAGCTGA
CCGTGCGGCCAGAACTCCTTGGTTGACGACGCGCCGACGAACGTGCCCCATCTGCAAGGGAGACGTGGTCCGGTC
TCTGGCCCGCGGCGGCTGCGACGGCCCCCGGTACGAGCCCTACCACGACGGCAGCGACAACGAGGCCGAGGTCGA
GGCCTCGGGCTCGCGGTCGGAGGGGGGCCCCTCGGACCCGGAACAGGGCATCCTGTCGCCCAGCAGCCGGGGCCG
GGAGCCGCCGCAGTCCGGCCGGCAGGAAGGGTGGCTCGGCCTGCTGTCGGGCAGCTTCGGCGCGCGGACCCGGCC
GCGGTCGCAGACGCCGCAGCCCCAAAGCCGCAGCCGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail