Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9884
Gene name
LocationContig_753:2607..4003
Strand+
Gene length (bp)1396
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 8.3E-18 50 187
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 3.0E-20 209 346

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 39 348 1.0E-106
sp|P50107|LGUL_YEAST Lactoylglutathione lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO1 PE=1 SV=1 34 347 1.0E-100
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 201 348 4.0E-47
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 23 191 1.0E-46
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 202 361 2.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 39 348 1.0E-106
sp|P50107|LGUL_YEAST Lactoylglutathione lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO1 PE=1 SV=1 34 347 1.0E-100
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 201 348 4.0E-47
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 23 191 1.0E-46
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 202 361 2.0E-44
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 48 193 2.0E-40
sp|Q9HU72|LGUL_PSEAE Lactoylglutathione lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gloA PE=3 SV=1 201 348 6.0E-40
sp|O04885|LGUL_BRAJU Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1 199 346 1.0E-39
sp|Q42891|LGUL_SOLLC Lactoylglutathione lyase OS=Solanum lycopersicum GN=GLX1 PE=2 SV=1 46 197 5.0E-39
sp|Q9ZS21|LGUL_SOYBN Lactoylglutathione lyase OS=Glycine max GN=GLXI PE=1 SV=1 26 193 7.0E-39
sp|Q9HU72|LGUL_PSEAE Lactoylglutathione lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gloA PE=3 SV=1 30 188 2.0E-38
sp|O04885|LGUL_BRAJU Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1 46 197 3.0E-38
sp|Q4R5F2|LGUL_MACFA Lactoylglutathione lyase OS=Macaca fascicularis GN=GLO1 PE=2 SV=3 46 188 4.0E-38
sp|Q4R5F2|LGUL_MACFA Lactoylglutathione lyase OS=Macaca fascicularis GN=GLO1 PE=2 SV=3 201 350 4.0E-38
sp|Q42891|LGUL_SOLLC Lactoylglutathione lyase OS=Solanum lycopersicum GN=GLX1 PE=2 SV=1 207 346 5.0E-38
sp|Q8H0V3|LGUL_ARATH Lactoylglutathione lyase OS=Arabidopsis thaliana GN=At1g08110 PE=2 SV=1 46 197 6.0E-38
sp|P50107|LGUL_YEAST Lactoylglutathione lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO1 PE=1 SV=1 200 356 1.0E-37
sp|Q9CPU0|LGUL_MOUSE Lactoylglutathione lyase OS=Mus musculus GN=Glo1 PE=1 SV=3 201 350 1.0E-37
sp|Q9CPU0|LGUL_MOUSE Lactoylglutathione lyase OS=Mus musculus GN=Glo1 PE=1 SV=3 34 188 1.0E-37
sp|O49818|LGUL_CICAR Lactoylglutathione lyase OS=Cicer arietinum PE=2 SV=1 46 193 2.0E-37
sp|Q8H0V3|LGUL_ARATH Lactoylglutathione lyase OS=Arabidopsis thaliana GN=At1g08110 PE=2 SV=1 200 346 3.0E-37
sp|Q6P7Q4|LGUL_RAT Lactoylglutathione lyase OS=Rattus norvegicus GN=Glo1 PE=1 SV=3 46 188 3.0E-37
sp|Q04760|LGUL_HUMAN Lactoylglutathione lyase OS=Homo sapiens GN=GLO1 PE=1 SV=4 46 188 3.0E-37
sp|Q6P7Q4|LGUL_RAT Lactoylglutathione lyase OS=Rattus norvegicus GN=Glo1 PE=1 SV=3 201 350 2.0E-36
sp|Q9ZS21|LGUL_SOYBN Lactoylglutathione lyase OS=Glycine max GN=GLXI PE=1 SV=1 207 360 2.0E-36
sp|Q04760|LGUL_HUMAN Lactoylglutathione lyase OS=Homo sapiens GN=GLO1 PE=1 SV=4 201 350 2.0E-36
sp|O49818|LGUL_CICAR Lactoylglutathione lyase OS=Cicer arietinum PE=2 SV=1 207 346 2.0E-35
sp|Q8W593|LGUC_ARATH Probable lactoylglutathione lyase, chloroplastic OS=Arabidopsis thaliana GN=At1g67280 PE=1 SV=1 36 349 6.0E-30
sp|Q948T6|LGUL_ORYSJ Lactoylglutathione lyase OS=Oryza sativa subsp. japonica GN=GLX-I PE=1 SV=2 49 357 1.0E-27
sp|Q39366|LGUL_BRAOG Putative lactoylglutathione lyase OS=Brassica oleracea var. gemmifera PE=2 SV=1 39 349 6.0E-25
sp|P46235|LGUL_VIBPA Probable lactoylglutathione lyase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloA PE=3 SV=2 211 353 2.0E-22
sp|P44638|LGUL_HAEIN Lactoylglutathione lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloA PE=1 SV=1 211 349 6.0E-21
sp|Q9KT93|LGUL_VIBCH Probable lactoylglutathione lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloA PE=3 SV=2 204 351 8.0E-21
sp|Q55595|LGUL_SYNY3 Probable lactoylglutathione lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gloA PE=3 SV=1 52 188 3.0E-20
sp|Q55595|LGUL_SYNY3 Probable lactoylglutathione lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gloA PE=3 SV=1 211 354 3.0E-20
sp|P0A1Q2|LGUL_SALTY Lactoylglutathione lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloA PE=3 SV=1 49 191 2.0E-19
sp|P0A1Q3|LGUL_SALTI Lactoylglutathione lyase OS=Salmonella typhi GN=gloA PE=3 SV=1 49 191 2.0E-19
sp|P0AC83|LGUL_SHIFL Lactoylglutathione lyase OS=Shigella flexneri GN=gloA PE=3 SV=1 49 191 6.0E-19
sp|P0AC81|LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) GN=gloA PE=1 SV=1 49 191 6.0E-19
sp|P0AC82|LGUL_ECO57 Lactoylglutathione lyase OS=Escherichia coli O157:H7 GN=gloA PE=3 SV=1 49 191 6.0E-19
sp|P0A1Q2|LGUL_SALTY Lactoylglutathione lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloA PE=3 SV=1 211 348 1.0E-18
sp|P0A1Q3|LGUL_SALTI Lactoylglutathione lyase OS=Salmonella typhi GN=gloA PE=3 SV=1 211 348 1.0E-18
sp|Q9KT93|LGUL_VIBCH Probable lactoylglutathione lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloA PE=3 SV=2 45 191 3.0E-18
sp|P46235|LGUL_VIBPA Probable lactoylglutathione lyase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloA PE=3 SV=2 52 191 5.0E-18
sp|P44638|LGUL_HAEIN Lactoylglutathione lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloA PE=1 SV=1 52 191 8.0E-18
sp|P0AC83|LGUL_SHIFL Lactoylglutathione lyase OS=Shigella flexneri GN=gloA PE=3 SV=1 211 348 2.0E-17
sp|P0AC81|LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) GN=gloA PE=1 SV=1 211 348 2.0E-17
sp|P0AC82|LGUL_ECO57 Lactoylglutathione lyase OS=Escherichia coli O157:H7 GN=gloA PE=3 SV=1 211 348 2.0E-17
sp|P0A0T3|LGUL_NEIMB Lactoylglutathione lyase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloA PE=3 SV=1 52 197 2.0E-17
sp|P0A0T2|LGUL_NEIMA Lactoylglutathione lyase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloA PE=3 SV=1 52 197 2.0E-17
sp|P0A0T3|LGUL_NEIMB Lactoylglutathione lyase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloA PE=3 SV=1 211 359 3.0E-17
sp|P0A0T2|LGUL_NEIMA Lactoylglutathione lyase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloA PE=3 SV=1 211 359 3.0E-17
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2124 0.1607 0.126 0.0447 0.8468 0.1356 0.0656 0.0282 0.0472 0.0743

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4693
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7561
Ophiocordyceps australis map64 (Brazil) OphauB2|5332
Ophiocordyceps camponoti-floridani Ophcf2|01427
Ophiocordyceps camponoti-rufipedis Ophun1|7073
Ophiocordyceps kimflemingae Ophio5|2053
Ophiocordyceps subramaniannii Hirsu2|9884 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9884
MNSSRAAQRLQSLHQILTPRSRVSSAVAPNQQHRTAATMASTTDLKTYKFNHSMIRIKDPKESVKFYEFLGMKLL
KKNQFPEAKFDLYFLGYDSPKALSHGKPVLDRQGLIELTHNYGTENDASYKVNTGNEEPHRGFGHTCISVDNIQA
ACQRIEDAGYKFQKKLTDGSMKQIAFALDPDGYWVEIIGQKPLEETADVKDTDVTTYHMNHTMIRVKDADKSLKF
YQEVLGMSLVRTHEAKGAGFTLYFLAYPGEKGLPKDGKTHDHEGILELTWNYGTEKKGDFKYHSGNEEPQGFGHI
CVSVDDLDAACQRFEDLKCSWKKRLVDGRMKNVAFLLDPDGYWVELVQNPRYSDKYQVAGL*
Coding >Hirsu2|9884
ATGAACTCGTCCAGAGCCGCACAGCGACTCCAAAGTCTTCATCAAATCCTTACTCCGAGGAGCCGCGTGTCGTCC
GCCGTCGCCCCAAACCAGCAGCACCGTACAGCCGCGACCATGGCGAGCACTACGGACCTGAAAACATACAAGTTC
AACCACTCCATGATCCGCATCAAGGATCCTAAGGAGTCCGTCAAGTTCTACGAGTTCTTGGGCATGAAGCTGCTC
AAGAAGAATCAGTTCCCCGAGGCCAAGTTCGACCTGTACTTCCTCGGCTATGACAGCCCCAAGGCGCTCTCCCAC
GGCAAGCCGGTCCTGGACCGCCAGGGCTTGATCGAGCTGACGCACAACTACGGGACCGAGAACGACGCGTCCTAC
AAGGTCAACACCGGCAACGAGGAACCGCACCGGGGCTTCGGCCACACCTGCATCAGCGTCGACAACATCCAGGCG
GCCTGCCAGCGAATCGAGGATGCCGGCTACAAGTTCCAGAAGAAGCTCACCGACGGCTCCATGAAGCAGATTGCC
TTTGCGCTGGATCCCGATGGCTACTGGGTCGAGATCATCGGCCAGAAGCCGCTCGAGGAGACGGCGGATGTCAAG
GACACGGACGTGACGACGTATCACATGAACCACACGATGATTCGAGTCAAGGACGCCGACAAGTCGCTCAAGTTC
TACCAGGAAGTGCTGGGGATGTCGCTCGTCAGAACGCACGAGGCCAAGGGCGCCGGCTTCACCCTGTACTTCCTC
GCCTACCCCGGCGAAAAGGGCCTGCCCAAGGACGGCAAGACGCACGATCACGAGGGGATCCTGGAACTGACCTGG
AACTATGGGACGGAGAAGAAGGGCGACTTCAAGTACCACAGCGGGAACGAGGAGCCGCAGGGCTTCGGACACATC
TGCGTGTCCGTCGACGACCTGGACGCGGCCTGTCAGCGGTTCGAGGACCTCAAGTGCAGCTGGAAGAAGCGACTC
GTGGATGGACGGATGAAGAACGTCGCGTTCCTGCTGGACCCGGACGGGTACTGGGTCGAGCTCGTCCAGAACCCC
CGATACAGCGACAAGTACCAGGTGGCGGGGTTGTAG
Transcript >Hirsu2|9884
ATGAACTCGTCCAGAGCCGCACAGCGACTCCAAAGTCTTCATCAAATCCTTACTCCGAGGAGCCGCGTGTCGTCC
GCCGTCGCCCCAAACCAGCAGCACCGTACAGCCGCGACCATGGCGAGCACTACGGACCTGAAAACATACAAGTTC
AACCACTCCATGATCCGCATCAAGGATCCTAAGGAGTCCGTCAAGTTCTACGAGTTCTTGGGCATGAAGCTGCTC
AAGAAGAATCAGTTCCCCGAGGCCAAGTTCGACCTGTACTTCCTCGGCTATGACAGCCCCAAGGCGCTCTCCCAC
GGCAAGCCGGTCCTGGACCGCCAGGGCTTGATCGAGCTGACGCACAACTACGGGACCGAGAACGACGCGTCCTAC
AAGGTCAACACCGGCAACGAGGAACCGCACCGGGGCTTCGGCCACACCTGCATCAGCGTCGACAACATCCAGGCG
GCCTGCCAGCGAATCGAGGATGCCGGCTACAAGTTCCAGAAGAAGCTCACCGACGGCTCCATGAAGCAGATTGCC
TTTGCGCTGGATCCCGATGGCTACTGGGTCGAGATCATCGGCCAGAAGCCGCTCGAGGAGACGGCGGATGTCAAG
GACACGGACGTGACGACGTATCACATGAACCACACGATGATTCGAGTCAAGGACGCCGACAAGTCGCTCAAGTTC
TACCAGGAAGTGCTGGGGATGTCGCTCGTCAGAACGCACGAGGCCAAGGGCGCCGGCTTCACCCTGTACTTCCTC
GCCTACCCCGGCGAAAAGGGCCTGCCCAAGGACGGCAAGACGCACGATCACGAGGGGATCCTGGAACTGACCTGG
AACTATGGGACGGAGAAGAAGGGCGACTTCAAGTACCACAGCGGGAACGAGGAGCCGCAGGGCTTCGGACACATC
TGCGTGTCCGTCGACGACCTGGACGCGGCCTGTCAGCGGTTCGAGGACCTCAAGTGCAGCTGGAAGAAGCGACTC
GTGGATGGACGGATGAAGAACGTCGCGTTCCTGCTGGACCCGGACGGGTACTGGGTCGAGCTCGTCCAGAACCCC
CGATACAGCGACAAGTACCAGGTGGCGGGGTTGTAG
Gene >Hirsu2|9884
ATGAACTCGTCCAGAGCCGCACAGCGACTCCAAAGTCTTCATCAAATCCTTACTCCGAGGAGCCGCGTGTCGTCC
GCCGTCGCCCCAAGTAGGCCGAAATGTCGCTGCCCGGACCACAGAGACTTTTACTGAACCTCGGCTTCTAGACCA
GCAGCACCGTACAGCCGCGACCATGGCGAGCACTACGGACCTGAAAACATACAAGTTCAACCACTCCATGTGAGC
AATGCCGGCCGCTCCCGTGCCTTGCATGATGAGCTGACATGGGCCAGGATCCGCATCAAGGATCCTAAGGAGTCC
GGTACGGCCTCGACCGACCCGAAAAGTGGCACCCTGAACGATGTGCGGCGCTGACTCGCCATCTGCAGTCAAGTT
CTACGAGTTCTTGGGCATGAAGCTGCTCAAGAAGAATCAGTTCCCCGAGGCCAAGTTCGACCTGTACTTCCTCGG
CTATGACAGCCCCAAGGCGCTCTCCCACGGCAAGCCGGTCCTGGACCGCCAGGGCTTGATCGAGCTGACGCACAA
CTACGGGACCGAGAACGACGCGTCCTACAAGGTCAACACCGGCAACGAGGAACCGCACCGGGGCTTCGGCCACAC
CTGCATCAGCGTCGACAACATCCAGGCGGCCTGCCAGCGAATCGAGGATGCCGGCTACAAGTTCCAGAAGAAGCT
CACCGACGGCTCCATGAAGCAGATTGCCTTTGCGCTGGATCCCGATGGCTACTGGGTCGAGATCATCGGCCAGAA
GCCGCTCGAGGAGACGGCGGATGTCAAGGACACGGACGTGACGACGTATCACATGGTAAGAGCCCGAGCTTTGGC
GCGGAAGAGAGTCCGCCGGCTGACGGTCGAGGCAGAACCACACGATGATTCGAGTCAAGGACGCCGACAAGTCGC
TCAAGTTCTACCAGGAAGTGCTGGGGATGTCGCTCGTCAGAACGCACGAGGCCAAGGGCGCCGGCTTCACCCTGT
ACTTCCTCGCCTACCCCGGCGAAAAGGGCCTGCCCAAGGACGGCAAGACGCACGATCACGAGGGGATCCTGGAAC
TGACCTGGAACTATGGGACGGAGAAGAAGGGCGACTTCAAGTACCACAGCGGGAACGAGGAGCCGCAGGGCTTCG
GACACATCTGTAAGTCCCCGGAAAGCCGGAACGCGTGTCGAGAAGCGAAGAGGAGCGCGACAAGGGACTGACCGT
TTTCCCCGCAGGCGTGTCCGTCGACGACCTGGACGCGGCCTGTCAGCGGTTCGAGGACCTCAAGTGCAGCTGGAA
GAAGCGACTCGTGGATGGACGGATGAAGAACGTCGCGTTCCTGCTGGACCCGGACGGGTACTGGGTCGAGCTCGT
CCAGAACCCCCGATACAGCGACAAGTACCAGGTGGCGGGGTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail