Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9882
Gene name
LocationContig_752:8435..9391
Strand-
Gene length (bp)956
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08660 Alg14 Oligosaccharide biosynthesis protein Alg14 like 2.8E-41 86 269

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WNB5|ALG14_ASPFU UDP-N-acetylglucosamine transferase subunit alg14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg14 PE=3 SV=1 113 272 2.0E-20
sp|O14199|ALG14_SCHPO UDP-N-acetylglucosamine transferase subunit alg14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg14 PE=3 SV=1 32 271 2.0E-19
sp|Q6BMD0|ALG14_DEBHA UDP-N-acetylglucosamine transferase subunit ALG14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG14 PE=3 SV=2 76 271 1.0E-15
sp|Q6AY85|ALG14_RAT UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Rattus norvegicus GN=Alg14 PE=2 SV=1 73 263 3.0E-13
sp|P0CM10|ALG14_CRYNJ UDP-N-acetylglucosamine transferase subunit ALG14 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ALG14 PE=3 SV=1 89 280 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WNB5|ALG14_ASPFU UDP-N-acetylglucosamine transferase subunit alg14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg14 PE=3 SV=1 113 272 2.0E-20
sp|O14199|ALG14_SCHPO UDP-N-acetylglucosamine transferase subunit alg14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg14 PE=3 SV=1 32 271 2.0E-19
sp|Q6BMD0|ALG14_DEBHA UDP-N-acetylglucosamine transferase subunit ALG14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG14 PE=3 SV=2 76 271 1.0E-15
sp|Q6AY85|ALG14_RAT UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Rattus norvegicus GN=Alg14 PE=2 SV=1 73 263 3.0E-13
sp|P0CM10|ALG14_CRYNJ UDP-N-acetylglucosamine transferase subunit ALG14 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ALG14 PE=3 SV=1 89 280 5.0E-13
sp|P0CM11|ALG14_CRYNB UDP-N-acetylglucosamine transferase subunit ALG14 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ALG14 PE=3 SV=1 89 280 5.0E-13
sp|Q96F25|ALG14_HUMAN UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Homo sapiens GN=ALG14 PE=1 SV=1 80 271 1.0E-12
sp|Q9D081|ALG14_MOUSE UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Mus musculus GN=Alg14 PE=1 SV=1 80 263 4.0E-12
sp|Q6CF02|ALG14_YARLI UDP-N-acetylglucosamine transferase subunit ALG14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG14 PE=3 SV=1 79 271 9.0E-12
sp|Q6FV75|ALG14_CANGA UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG14 PE=3 SV=1 40 267 1.0E-11
sp|P38242|ALG14_YEAST UDP-N-acetylglucosamine transferase subunit ALG14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG14 PE=1 SV=1 71 267 3.0E-08
sp|Q5A5N6|ALG14_CANAL UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG14 PE=3 SV=1 87 275 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0009058 biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 12 29 17
2 33 51 18
3 164 186 22
4 201 223 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9882
MSSRAISAPRRTAVAAGGTAGLALLCLSCRWKTLMLTCLALLVALAVFVTARHAQIVALRRATRWPRPPWLSRER
PGRRRSAQHYLFVLGSGGHTKEMLMMMDDGFRDFAGCHRRYLISSGDRVSHHQLEDYEKQLAQLCRAADSSPGSY
DTRVVARARRVHQSLWTTPLTSLLSIVAVFSVLLSPPPGPTGERLPYPTQIFSNGPATGFFVGLAAHLLKIFYVV
PEDSMRFVYIESWARISTLSLTGRLLLYTDVADAFYVQHQELAAAHGLVNAGEMVFNSRRADAQPSPLV*
Coding >Hirsu2|9882
ATGAGCAGCCGTGCGATCTCGGCGCCCAGGCGGACGGCCGTGGCCGCAGGTGGCACCGCCGGGCTCGCCCTGCTA
TGCCTCAGCTGCCGATGGAAGACGCTGATGCTCACGTGCCTGGCTCTGCTCGTAGCCTTGGCCGTCTTCGTCACC
GCGCGCCATGCACAGATCGTCGCCCTTCGCCGCGCGACGCGCTGGCCGAGGCCGCCGTGGCTGAGTCGAGAGCGG
CCGGGCCGGCGGCGCTCCGCGCAGCACTACCTCTTCGTCCTCGGGTCCGGCGGCCACACCAAGGAGATGCTCATG
ATGATGGACGACGGCTTCCGCGACTTTGCCGGCTGCCACCGCCGCTATCTCATCTCGAGCGGCGACCGCGTGTCG
CACCACCAGCTCGAGGACTACGAGAAGCAGCTGGCGCAGCTGTGCCGGGCCGCCGACTCGTCGCCCGGGAGCTAC
GACACGCGCGTCGTCGCCCGTGCCCGCCGCGTCCACCAGTCCCTCTGGACGACGCCCTTGACCTCGCTCCTCAGC
ATCGTCGCCGTCTTCTCCGTCCTGCTGTCGCCGCCGCCGGGCCCGACCGGCGAGCGGCTGCCGTATCCCACGCAG
ATCTTCTCCAACGGCCCGGCCACGGGCTTCTTCGTCGGCCTCGCCGCCCACCTGCTCAAGATTTTCTACGTCGTG
CCCGAGGACAGCATGCGGTTCGTCTACATCGAGTCCTGGGCGCGCATCTCGACCCTGAGCCTGACGGGGAGGCTC
TTGCTGTACACGGACGTGGCGGACGCTTTCTACGTGCAGCACCAGGAGCTTGCTGCCGCACATGGCCTGGTCAAC
GCCGGCGAGATGGTCTTCAACTCGAGGCGGGCAGATGCGCAACCGTCGCCTCTGGTGTAG
Transcript >Hirsu2|9882
ATGAGCAGCCGTGCGATCTCGGCGCCCAGGCGGACGGCCGTGGCCGCAGGTGGCACCGCCGGGCTCGCCCTGCTA
TGCCTCAGCTGCCGATGGAAGACGCTGATGCTCACGTGCCTGGCTCTGCTCGTAGCCTTGGCCGTCTTCGTCACC
GCGCGCCATGCACAGATCGTCGCCCTTCGCCGCGCGACGCGCTGGCCGAGGCCGCCGTGGCTGAGTCGAGAGCGG
CCGGGCCGGCGGCGCTCCGCGCAGCACTACCTCTTCGTCCTCGGGTCCGGCGGCCACACCAAGGAGATGCTCATG
ATGATGGACGACGGCTTCCGCGACTTTGCCGGCTGCCACCGCCGCTATCTCATCTCGAGCGGCGACCGCGTGTCG
CACCACCAGCTCGAGGACTACGAGAAGCAGCTGGCGCAGCTGTGCCGGGCCGCCGACTCGTCGCCCGGGAGCTAC
GACACGCGCGTCGTCGCCCGTGCCCGCCGCGTCCACCAGTCCCTCTGGACGACGCCCTTGACCTCGCTCCTCAGC
ATCGTCGCCGTCTTCTCCGTCCTGCTGTCGCCGCCGCCGGGCCCGACCGGCGAGCGGCTGCCGTATCCCACGCAG
ATCTTCTCCAACGGCCCGGCCACGGGCTTCTTCGTCGGCCTCGCCGCCCACCTGCTCAAGATTTTCTACGTCGTG
CCCGAGGACAGCATGCGGTTCGTCTACATCGAGTCCTGGGCGCGCATCTCGACCCTGAGCCTGACGGGGAGGCTC
TTGCTGTACACGGACGTGGCGGACGCTTTCTACGTGCAGCACCAGGAGCTTGCTGCCGCACATGGCCTGGTCAAC
GCCGGCGAGATGGTCTTCAACTCGAGGCGGGCAGATGCGCAACCGTCGCCTCTGGTGTAG
Gene >Hirsu2|9882
ATGAGCAGCCGTGCGATCTCGGCGCCCAGGCGGACGGCCGTGGCCGCAGGTGGCACCGCCGGGCTCGCCCTGCTA
TGCCTCAGCTGCCGATGGAAGACGCTGATGCTCACGTGCCTGGCTCTGCTCGTAGCCTTGGCCGTCTTCGTCACC
GTGCGGCTTCCCCTTCCCTCCCCTTTCCCCGAACGCCGGCTCGCAGGGCCTGGACTGAGAACAAAAAACAGGCGC
GCCATGCACAGATCGTCGCCCTTCGCCGCGCGACGCGCTGGCCGAGGCCGCCGTGGCTGAGTCGAGAGCGGCCGG
GCCGGCGGCGCTCCGCGCAGCACTACCTCTTCGTCCTCGGGTCCGGCGGCCACACCAAGGAGATGCTCATGATGA
TGGACGACGGCTTCCGCGACTTTGCCGGCTGCCACCGCCGCTATCTCATCTCGAGCGGCGACCGCGTGTCGCACC
ACCAGCTCGAGGACTACGAGAAGCAGCTGGCGCAGCTGTGCCGGGCCGCCGACTCGTCGCCCGGGAGCTACGACA
CGCGCGTCGTCGCCCGTGCCCGCCGCGTCCACCAGTCCCTCTGGACGACGCCCTTGACCTCGCTCCTCAGCATCG
TCGCCGTCTTCTCCGTCCTGCTGTCGCCGCCGCCGGGCCCGACCGGCGAGCGGCTGCCGTATCCCACGCAGATCT
TCTCCAACGGCCCGGCCACGGGCTTCTTCGTCGGCCTCGCCGCCCACCTGCTCAAGATTTTCTACGTCGTGCCCG
AGGACAGCATGCGGTTCGTCTACATCGAGTCCTGGGCGCGCATCTCGACCCTGAGCCTGACGGGGAGGCTCTTGC
TGTACACGGACGTGGCGGACGCTTTCTACGTGCAGCACCAGGAGCTTGCTGCCGCACATGGCCTGGTCAACGCCG
GCGAGATGGTCTTCAACTCGAGGCGGGCAGATGCGCAACCGTCGCCTCTGGTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail