Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9879
Gene name
LocationContig_752:4516..5105
Strand+
Gene length (bp)589
Transcript length (bp)327
Coding sequence length (bp)327
Protein length (aa) 109

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02935 COX7C Cytochrome c oxidase subunit VIIc 9.3E-24 43 106

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0004129 cytochrome-c oxidase activity Yes
GO:0008324 cation transmembrane transporter activity No
GO:0016491 oxidoreductase activity No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0016675 oxidoreductase activity, acting on a heme group of donors No
GO:0015002 heme-copper terminal oxidase activity No
GO:0003824 catalytic activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022857 transmembrane transporter activity No
GO:0016676 oxidoreductase activity, acting on a heme group of donors, oxygen as acceptor No
GO:0005215 transporter activity No
GO:0009055 electron transfer activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 80 102 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9879
MPTRHGPCRNRILKAHAKAPSDLQRIASNCSKMLPRAAARTTTSLASRRAFHTTRPRLSSPYHYPEGPYTNIPFN
PHKRWFAVGYWSFLATGFFAPFGIAVFQTYKEH*
Coding >Hirsu2|9879
ATGCCCACGCGCCACGGGCCTTGCCGAAACCGCATCTTGAAGGCACACGCCAAAGCTCCCTCCGACCTCCAACGC
ATCGCGTCCAACTGTTCCAAGATGCTTCCCCGCGCCGCCGCCCGCACTACGACCTCGCTGGCCTCCCGCCGAGCC
TTCCACACCACCAGGCCACGCCTGTCTTCGCCTTACCACTACCCCGAGGGCCCCTACACCAATATCCCCTTCAAC
CCGCACAAGCGGTGGTTCGCCGTCGGCTACTGGTCTTTCCTCGCCACCGGCTTCTTCGCCCCCTTCGGCATTGCC
GTGTTCCAGACCTACAAGGAGCACTAA
Transcript >Hirsu2|9879
ATGCCCACGCGCCACGGGCCTTGCCGAAACCGCATCTTGAAGGCACACGCCAAAGCTCCCTCCGACCTCCAACGC
ATCGCGTCCAACTGTTCCAAGATGCTTCCCCGCGCCGCCGCCCGCACTACGACCTCGCTGGCCTCCCGCCGAGCC
TTCCACACCACCAGGCCACGCCTGTCTTCGCCTTACCACTACCCCGAGGGCCCCTACACCAATATCCCCTTCAAC
CCGCACAAGCGGTGGTTCGCCGTCGGCTACTGGTCTTTCCTCGCCACCGGCTTCTTCGCCCCCTTCGGCATTGCC
GTGTTCCAGACCTACAAGGAGCACTAA
Gene >Hirsu2|9879
ATGCCCACGCGCCACGGGCCTTGCCGAAGTTGAGCCGCCGATCGGCTCTGGTAGAAATCGACGGCATTCGGAACA
TTGCTGCTCCGTGGCCGGCAAGGTCACTCCAGTCACGTGGACGCCCGTTTCCAGGCACTGCTTGCCTCAGACCAC
GAGCATCACGACTTTTAGACCGCATCTTGAAGGCACACGCCAAAGCTCCCTCCGACCTCCAACGCATCGCGTCCA
ACTGTTCCAAGGTTCGTTGCCTCCAGAATTGGCTTGCTATTCCCCGCCAACAGCTAATCGAGCTTGCAAGATGCT
TCCCCGCGCCGCCGCCCGCACTACGACCTCGCTGGCCTCCCGCCGAGCCTTCCACACCACCAGGCCACGCCTGTC
TTCGCCTTACCACTACCCCGAGGGCCCCTACACCAATATCCCCTTCAACCCGCACAAGCGGTGGTTCGCCGTCGG
CTACTGGTCTTTCCTCGCCACCGGCTTCTTCGCCCCCTTCGGCATTGCCGGTCCGTCCAAATTGCAACCCGACTG
CCGCTGGACCCCTATCCGACTGACTGTCCGAGATGCAGTGTTCCAGACCTACAAGGAGCACTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail