Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9876
Gene name
LocationContig_751:4251..9966
Strand+
Gene length (bp)5715
Transcript length (bp)5427
Coding sequence length (bp)5427
Protein length (aa) 1809

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04118 Dopey_N Dopey, N-terminal 3.6E-116 40 366

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B3|DOP1_EMENI Protein dopey OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dop1 PE=1 SV=1 32 1785 0.0E+00
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 40 943 3.0E-75
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 39 364 2.0E-55
sp|Q642P2|DOP2_XENLA Protein dopey-2 OS=Xenopus laevis GN=dopey2 PE=2 SV=1 33 453 2.0E-54
sp|Q3UHQ6|DOP2_MOUSE Protein dopey-2 OS=Mus musculus GN=Dopey2 PE=1 SV=3 33 459 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B3|DOP1_EMENI Protein dopey OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dop1 PE=1 SV=1 32 1785 0.0E+00
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 40 943 3.0E-75
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 39 364 2.0E-55
sp|Q642P2|DOP2_XENLA Protein dopey-2 OS=Xenopus laevis GN=dopey2 PE=2 SV=1 33 453 2.0E-54
sp|Q3UHQ6|DOP2_MOUSE Protein dopey-2 OS=Mus musculus GN=Dopey2 PE=1 SV=3 33 459 2.0E-52
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=2 SV=1 33 521 4.0E-52
sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus GN=Dopey1 PE=1 SV=2 33 521 6.0E-52
sp|Q9Y3R5|DOP2_HUMAN Protein dopey-2 OS=Homo sapiens GN=DOPEY2 PE=1 SV=5 33 459 3.0E-51
sp|Q292H2|DOP1_DROPS Protein dopey-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA13490 PE=3 SV=1 31 514 3.0E-48
sp|A1ZBE8|DOP1_DROME Protein dopey-1 homolog OS=Drosophila melanogaster GN=CG15099 PE=1 SV=1 31 511 5.0E-47
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 1210 1791 7.0E-43
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 1106 1784 9.0E-42
sp|Q9XW10|PAD1_CAEEL Protein pad-1 OS=Caenorhabditis elegans GN=pad-1 PE=2 SV=2 39 460 2.0E-37
sp|Q5WNI9|PAD1_CAEBR Protein pad-1 OS=Caenorhabditis briggsae GN=pad-1 PE=3 SV=1 39 466 4.0E-37
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=2 SV=1 1122 1774 8.0E-15
sp|Q642P2|DOP2_XENLA Protein dopey-2 OS=Xenopus laevis GN=dopey2 PE=2 SV=1 1359 1760 2.0E-10
sp|A1ZBE8|DOP1_DROME Protein dopey-1 homolog OS=Drosophila melanogaster GN=CG15099 PE=1 SV=1 1306 1765 5.0E-10
sp|Q292H2|DOP1_DROPS Protein dopey-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA13490 PE=3 SV=1 1381 1765 2.0E-09
sp|O97239|DOP1_PLAF7 Protein dopey homolog PFC0245c OS=Plasmodium falciparum (isolate 3D7) GN=PFC0245c PE=2 SV=1 44 162 2.0E-09
sp|Q9XW10|PAD1_CAEEL Protein pad-1 OS=Caenorhabditis elegans GN=pad-1 PE=2 SV=2 1546 1761 1.0E-07
sp|Q3UHQ6|DOP2_MOUSE Protein dopey-2 OS=Mus musculus GN=Dopey2 PE=1 SV=3 1109 1762 1.0E-06
sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus GN=Dopey1 PE=1 SV=2 1394 1774 2.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4196 0.6668 0.1735 0.0737 0.0382 0.013 0.3084 0.1725 0.4795 0.0072

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4686
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6222
Ophiocordyceps australis map64 (Brazil) OphauB2|292
Ophiocordyceps camponoti-floridani Ophcf2|00193
Ophiocordyceps camponoti-rufipedis Ophun1|3429
Ophiocordyceps kimflemingae Ophio5|4389
Ophiocordyceps subramaniannii Hirsu2|9876 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9876
MALESGPGAPSGSPESSERDSPIPRRWRTQLGEDEQPIKDKAYRKYASGVEKALSLFETALEEWADYISFLNKLL
KALQARPTSITAIPTKATVAKRLSQCLNPALPSGVHQKALEVYNYVFTVIGREGLSRDLPLYLSGLAPTLSFASL
AVRAPYLHLLESHFLQIDPRSLRPAMKSIILALLPGLEDETSEDFDRTLSLVTGFKKAVRPQDSEKLTENHASGD
DFFWQCFFLACITGNSRRSGALAYLVRYLPVLGPVPSAAGSDAAPPNKDDDENSKICLMVTSPEPGLLVRCLASG
LADDQILIQRGFLDLLVTHLPLNSSVLQSRVKPADLEFLLRAAVGVVTRRDMSLNRRLWAWLLGPEPTGGEGEQT
DDQLASSPGQQQAFLSSRTSYFEEYGLQPLTRTLLDMIRGAVGGNAAERARPYRICLSLMDRWEIGGLIVSEVFL
PVIESVRQFQSQAPAKAEFAEVLRSASVFFDGIESGLIFSELARLLTQALGMGHGSMADRADKISLVNFIISNFN
VREEEMVTVHAPLTCLAALSLLEDLRTRRAENGLTDVETAELSEQSLNVIASMVELVPDRAFPVARNEAPGSRPG
SGAALSVSNADILKKMEAFYVHEQGNLDSCPAPFSAVESGELLLQKAVKYICDEDSARWNQDMGVRVRVFVLVLL
KTPTSYEFDVDKPMSHLKRHLRRDGRLPFSCFSSVLQLATQLYSAERISAMQLSDLVAPLVGHAWSYLSASDPKY
HVETVRCLWQLQTALTPWNREMEAAISSILVARQSKSLGAASFAEAARTFGVLWSHTLQDTAADRRGPKTPTQEL
KSSPRLAGMDHYQVMLTQPLFLILDSLLDERTQVYMVVKSWLNSTIGIDRLFLLFVAKLAEIPCLSSVGTRGGGE
KRADAEPIDFNEDDDLDLFLYYLRTLHRVLRCTEDVPRAVLASRYLYFGGGEVQIRGSAEEGEMTLQDYFVRVCV
ECITAEVVPTAGDDVVERVSQLRRYALTILHEFLSSHHAVPVTQLQLDNILYDRLAKSISTPDPYVQVLLLDVIH
DTLKLQEMAAGERPATPAPERMPPSLDRARTSRTSLAMSDGAASGPSMPPQLLKCLQAGLSSTSSHSVLDSWIGF
LGDLLPFFSHAIFQALIPLVETLCRQIAATLSSLRDTFQADAPRACPAGSPPESALFYLLNGLERVLALGHDQLV
TEESQARLLKGPEQPQSLFGSMVSGVFQSDTAQSRSSTANDRLTVHLAFQDTMRTCYKIWSWGQGDEAKKQDPVS
LASFNHTSLRMRNRARRLLEHLFAAETLECLETVIDIWKSAGTAAERAQVFNFLSALDACRPKHCVPALFNSIYS
RTNPGALDPSRKSAMTISLLDSDLVVFLVEYARSLDDDAMDEIWQDCMTFLRDLLGNPFPHRQTLPSLLEFAAIL
GEKVDNTNFGEQRRMRRELGDLFLRLLAALFTTRPMTFAEANGATERSGKDNTGRRSTLSSAAEGSDNVVSVLAS
IVPKLPKILLENERVLSAAATMSTHVIGPALRSRAFPETMSQKVMRLLAELSRLPNNQKTWKKDVGDAFYDGRFF
GTRLELVGSDWLPLLRQWALTDKERMPEMVGRISAPTTAGIVFGVGATSARFEADRRTQLVLRRMATLVAASAED
AFVAELPAMLDKLVELLAATATSSPSSTTRADLFLVVRALVLKTSAVHLAMLWPVLNAELHAVLASAAAPEHSAA
WETYGNAAVLQACKLLDLLVCVAPDDFQLHEWLFVTDTVDAVYRSSAHQPVALVDELSEETAGAAAATAGARTGI
ELALCLAW*
Coding >Hirsu2|9876
ATGGCCCTCGAGTCGGGGCCTGGCGCCCCCTCGGGGTCTCCCGAAAGCTCAGAACGCGACTCGCCCATCCCTCGA
CGCTGGAGGACCCAGCTTGGTGAAGATGAGCAGCCCATCAAGGACAAAGCATACCGCAAATATGCGTCCGGGGTC
GAGAAGGCGCTGTCGCTATTCGAGACGGCTCTGGAGGAATGGGCAGACTACATATCCTTCCTGAACAAGCTTCTC
AAGGCTCTGCAAGCTCGGCCGACTTCCATCACGGCGATCCCCACGAAAGCGACCGTCGCCAAACGCCTGTCCCAA
TGCCTCAACCCCGCGCTGCCGTCAGGCGTCCACCAGAAGGCCCTCGAAGTTTACAATTACGTCTTCACCGTGATC
GGGAGAGAGGGCTTGTCCCGCGACCTCCCGTTGTATCTGTCCGGGCTCGCTCCCACGCTCTCCTTCGCCTCTCTC
GCCGTTCGAGCGCCTTACCTGCATCTGTTGGAATCGCACTTTCTCCAAATCGACCCGCGCTCTCTGAGACCGGCA
ATGAAGTCCATAATACTGGCGCTGCTACCAGGCTTGGAAGACGAGACGAGCGAGGACTTTGACCGCACCTTGAGC
CTCGTCACGGGCTTCAAGAAGGCTGTCAGGCCTCAGGACAGCGAAAAGCTCACCGAGAACCATGCCTCGGGCGAC
GACTTCTTCTGGCAATGCTTCTTCTTGGCATGCATCACCGGCAACAGCCGCCGCTCCGGGGCCTTGGCATATTTG
GTGCGCTATCTGCCGGTGCTGGGGCCCGTCCCGTCCGCAGCCGGCTCTGATGCGGCGCCGCCCAACAAGGACGAC
GACGAAAACTCCAAAATCTGCCTCATGGTGACTTCTCCCGAGCCCGGGCTGTTGGTCCGCTGCCTCGCCAGTGGC
TTGGCTGACGATCAAATACTCATCCAACGCGGCTTTCTCGATCTCTTGGTGACGCACTTGCCCCTGAACTCGAGC
GTGCTGCAATCTCGTGTGAAACCGGCCGATCTCGAGTTCCTCCTGAGGGCTGCTGTCGGGGTGGTCACGAGACGA
GACATGAGCCTGAACAGGCGGCTGTGGGCATGGCTCCTCGGCCCCGAACCAACCGGCGGCGAAGGGGAACAGACC
GATGACCAGCTAGCGTCCTCTCCCGGTCAACAGCAGGCGTTCCTTTCGTCCAGGACCAGCTACTTCGAGGAATAT
GGCCTGCAGCCGCTGACGAGAACCCTGCTCGACATGATCAGGGGCGCTGTCGGCGGAAACGCCGCAGAGCGAGCC
CGGCCGTACAGGATCTGCCTGTCTCTGATGGACAGGTGGGAGATCGGAGGCCTGATCGTATCTGAAGTCTTCCTG
CCGGTCATCGAGAGTGTACGACAATTCCAGAGTCAGGCTCCTGCCAAGGCCGAGTTCGCAGAAGTACTGCGAAGC
GCAAGCGTCTTCTTCGACGGCATCGAGAGCGGTCTGATCTTCAGCGAGCTCGCCAGACTTCTGACTCAGGCACTT
GGCATGGGACACGGCAGCATGGCCGATCGAGCGGACAAGATCTCGCTCGTCAACTTCATCATCTCCAACTTTAAC
GTGCGCGAAGAAGAAATGGTCACTGTTCACGCACCTCTCACCTGCCTGGCTGCCCTGTCTCTGCTGGAAGACCTT
CGGACTCGCAGAGCAGAAAACGGTTTGACAGACGTCGAAACGGCCGAGTTGTCGGAACAATCGTTGAACGTAATC
GCATCAATGGTAGAGCTGGTACCGGACCGGGCTTTTCCAGTCGCCCGAAATGAGGCGCCGGGCTCCCGACCGGGA
TCGGGGGCGGCACTGTCCGTCTCCAACGCGGACATACTCAAAAAGATGGAGGCATTCTACGTCCATGAGCAGGGC
AACCTCGATTCTTGCCCGGCCCCCTTCAGCGCAGTCGAATCAGGAGAATTGCTGCTACAGAAAGCTGTCAAGTAC
ATTTGCGATGAGGACAGCGCGAGATGGAATCAGGATATGGGCGTGCGCGTGCGCGTCTTCGTTCTCGTTCTACTG
AAGACGCCGACATCTTATGAGTTTGACGTGGACAAGCCCATGTCCCACTTGAAGAGACACCTGCGACGGGATGGC
CGGCTGCCCTTCTCCTGCTTCTCGTCGGTGCTCCAGCTGGCCACGCAGCTCTATTCCGCCGAAAGGATCAGTGCG
ATGCAGCTGTCTGACCTGGTGGCGCCTCTGGTCGGCCACGCGTGGTCATACCTGTCGGCTTCCGACCCAAAATAC
CATGTAGAGACTGTCCGCTGTCTGTGGCAACTGCAGACTGCGCTCACGCCATGGAATCGCGAGATGGAGGCAGCC
ATCTCGAGCATCCTAGTAGCACGCCAGTCAAAAAGCCTCGGGGCCGCGAGCTTCGCCGAGGCAGCGCGCACTTTC
GGCGTCCTGTGGTCGCATACGCTCCAAGATACCGCTGCTGATCGCCGAGGCCCGAAGACGCCGACTCAGGAGCTC
AAGTCGTCTCCCCGACTGGCGGGCATGGATCATTACCAGGTCATGTTGACCCAGCCGCTTTTCCTCATCCTGGAC
TCGCTGCTCGATGAGCGAACACAGGTGTACATGGTTGTCAAGTCCTGGCTCAACAGCACGATCGGCATTGACAGA
CTCTTCCTCCTCTTCGTGGCCAAGTTGGCCGAAATTCCATGTCTATCGTCCGTCGGCACCAGAGGTGGCGGCGAA
AAAAGAGCCGATGCCGAGCCCATCGATTTCAACGAGGACGACGATTTGGATCTCTTCTTGTACTACCTGCGGACC
CTGCACCGTGTGCTTCGCTGCACCGAAGACGTGCCACGAGCGGTCCTGGCCTCGAGGTATCTCTACTTTGGCGGT
GGAGAGGTGCAAATCCGCGGGAGTGCCGAGGAGGGCGAGATGACTCTCCAAGACTATTTCGTTCGCGTATGCGTA
GAGTGTATCACGGCAGAGGTGGTGCCCACTGCTGGCGACGATGTGGTCGAGCGAGTCTCTCAACTCCGTCGATAT
GCGTTGACCATCCTCCACGAGTTTCTCTCGAGCCATCACGCTGTTCCGGTCACCCAGCTGCAGCTCGACAACATT
TTGTACGACAGGCTGGCCAAGTCCATCAGCACGCCAGACCCATACGTTCAGGTCCTGCTTCTCGATGTCATCCAC
GACACGCTCAAGCTCCAGGAGATGGCAGCTGGAGAGCGTCCCGCTACACCGGCACCCGAGAGAATGCCGCCGAGC
CTTGATCGGGCCCGAACCAGCCGAACGTCGCTCGCCATGAGCGACGGCGCGGCCAGCGGGCCGTCGATGCCTCCT
CAACTTCTCAAATGTCTGCAGGCCGGACTGAGCTCCACCAGCAGCCACTCGGTTCTGGACAGCTGGATAGGCTTT
CTGGGAGACCTGCTGCCGTTCTTTTCCCATGCGATCTTCCAAGCCTTGATACCGCTCGTCGAAACGCTGTGCAGG
CAGATCGCGGCGACGCTGTCCAGCCTCCGCGACACGTTCCAGGCGGATGCTCCACGGGCGTGCCCGGCCGGAAGC
CCGCCGGAATCCGCCTTGTTCTACCTGCTGAACGGTCTGGAGCGGGTGCTCGCCCTCGGCCACGACCAGCTTGTC
ACGGAAGAGAGCCAAGCGCGGCTGTTGAAGGGGCCCGAGCAGCCGCAGTCTCTCTTCGGGAGCATGGTGTCGGGC
GTGTTTCAATCGGACACGGCGCAGTCGCGGAGCTCGACGGCGAATGATCGCCTGACGGTCCACCTGGCCTTCCAG
GATACCATGCGCACATGCTACAAGATCTGGTCGTGGGGCCAGGGGGACGAGGCCAAGAAGCAGGACCCCGTCTCG
CTGGCGTCCTTCAACCACACGTCACTGCGGATGAGAAACCGGGCGCGACGGCTGCTCGAGCACCTCTTCGCCGCC
GAGACGCTCGAGTGTCTGGAGACGGTGATTGACATCTGGAAGTCGGCCGGCACAGCGGCCGAGCGCGCCCAAGTA
TTCAACTTTTTGTCGGCTCTGGACGCGTGCCGGCCCAAGCATTGCGTGCCAGCCCTCTTCAACTCCATCTACAGC
CGGACCAACCCGGGCGCCCTGGACCCGTCGCGGAAGTCGGCCATGACCATCTCTCTCCTGGATTCCGACCTGGTC
GTCTTCCTGGTCGAGTACGCGCGCTCCCTCGACGACGATGCGATGGACGAGATCTGGCAGGACTGCATGACCTTC
CTCCGGGACCTGCTGGGAAACCCGTTCCCGCACAGGCAGACGCTGCCGAGCCTGCTCGAGTTTGCGGCCATCCTG
GGCGAGAAGGTGGACAATACGAACTTTGGAGAGCAGCGGAGGATGCGTCGGGAGCTGGGGGATCTCTTCCTGCGC
CTCCTCGCAGCGCTCTTCACCACCCGTCCCATGACGTTTGCCGAGGCGAACGGTGCGACGGAGAGGTCCGGCAAG
GACAACACCGGTCGGCGGAGCACGCTGAGCAGCGCGGCCGAGGGGTCGGACAATGTGGTGTCCGTCTTGGCGTCG
ATTGTGCCCAAGCTGCCCAAGATTCTGCTGGAGAACGAGCGGGTGCTGTCGGCGGCGGCGACGATGTCGACGCAC
GTCATCGGGCCGGCGCTGCGGTCCAGGGCCTTCCCCGAGACGATGTCGCAGAAGGTGATGCGGCTGCTGGCGGAG
CTGTCGCGGCTGCCCAACAACCAGAAGACGTGGAAGAAGGACGTGGGCGACGCCTTTTACGACGGCAGGTTCTTC
GGCACGAGGCTGGAGCTGGTCGGGAGCGACTGGCTGCCGCTGCTGCGCCAGTGGGCGCTGACGGACAAGGAGCGG
ATGCCGGAGATGGTGGGGCGGATCAGCGCGCCGACAACGGCCGGCATCGTCTTCGGCGTGGGCGCGACGTCGGCC
CGGTTCGAGGCGGACCGGCGGACGCAGCTGGTGCTGCGGCGGATGGCGACGCTGGTGGCGGCGTCGGCCGAGGAC
GCCTTCGTGGCGGAGCTGCCGGCGATGCTGGACAAGCTGGTGGAGCTGCTGGCGGCGACGGCGACGTCGTCGCCG
TCGTCGACGACGCGGGCCGACCTGTTCCTGGTGGTGCGGGCGCTGGTGCTGAAGACGAGCGCGGTGCACCTGGCG
ATGCTGTGGCCGGTGCTGAACGCGGAGCTGCACGCGGTGCTGGCGTCGGCGGCGGCGCCCGAGCACAGCGCCGCG
TGGGAGACGTACGGCAACGCGGCGGTGCTGCAGGCGTGCAAGCTGCTGGACCTGCTCGTCTGCGTGGCGCCCGAC
GACTTTCAGCTGCACGAGTGGCTGTTCGTGACGGACACGGTCGACGCCGTCTACCGCTCGTCGGCCCACCAGCCC
GTCGCCCTGGTCGACGAGCTGTCGGAGGAGACGGCGGGCGCGGCGGCGGCGACGGCGGGGGCACGGACGGGCATT
GAACTGGCCCTTTGTCTGGCTTGGTGA
Transcript >Hirsu2|9876
ATGGCCCTCGAGTCGGGGCCTGGCGCCCCCTCGGGGTCTCCCGAAAGCTCAGAACGCGACTCGCCCATCCCTCGA
CGCTGGAGGACCCAGCTTGGTGAAGATGAGCAGCCCATCAAGGACAAAGCATACCGCAAATATGCGTCCGGGGTC
GAGAAGGCGCTGTCGCTATTCGAGACGGCTCTGGAGGAATGGGCAGACTACATATCCTTCCTGAACAAGCTTCTC
AAGGCTCTGCAAGCTCGGCCGACTTCCATCACGGCGATCCCCACGAAAGCGACCGTCGCCAAACGCCTGTCCCAA
TGCCTCAACCCCGCGCTGCCGTCAGGCGTCCACCAGAAGGCCCTCGAAGTTTACAATTACGTCTTCACCGTGATC
GGGAGAGAGGGCTTGTCCCGCGACCTCCCGTTGTATCTGTCCGGGCTCGCTCCCACGCTCTCCTTCGCCTCTCTC
GCCGTTCGAGCGCCTTACCTGCATCTGTTGGAATCGCACTTTCTCCAAATCGACCCGCGCTCTCTGAGACCGGCA
ATGAAGTCCATAATACTGGCGCTGCTACCAGGCTTGGAAGACGAGACGAGCGAGGACTTTGACCGCACCTTGAGC
CTCGTCACGGGCTTCAAGAAGGCTGTCAGGCCTCAGGACAGCGAAAAGCTCACCGAGAACCATGCCTCGGGCGAC
GACTTCTTCTGGCAATGCTTCTTCTTGGCATGCATCACCGGCAACAGCCGCCGCTCCGGGGCCTTGGCATATTTG
GTGCGCTATCTGCCGGTGCTGGGGCCCGTCCCGTCCGCAGCCGGCTCTGATGCGGCGCCGCCCAACAAGGACGAC
GACGAAAACTCCAAAATCTGCCTCATGGTGACTTCTCCCGAGCCCGGGCTGTTGGTCCGCTGCCTCGCCAGTGGC
TTGGCTGACGATCAAATACTCATCCAACGCGGCTTTCTCGATCTCTTGGTGACGCACTTGCCCCTGAACTCGAGC
GTGCTGCAATCTCGTGTGAAACCGGCCGATCTCGAGTTCCTCCTGAGGGCTGCTGTCGGGGTGGTCACGAGACGA
GACATGAGCCTGAACAGGCGGCTGTGGGCATGGCTCCTCGGCCCCGAACCAACCGGCGGCGAAGGGGAACAGACC
GATGACCAGCTAGCGTCCTCTCCCGGTCAACAGCAGGCGTTCCTTTCGTCCAGGACCAGCTACTTCGAGGAATAT
GGCCTGCAGCCGCTGACGAGAACCCTGCTCGACATGATCAGGGGCGCTGTCGGCGGAAACGCCGCAGAGCGAGCC
CGGCCGTACAGGATCTGCCTGTCTCTGATGGACAGGTGGGAGATCGGAGGCCTGATCGTATCTGAAGTCTTCCTG
CCGGTCATCGAGAGTGTACGACAATTCCAGAGTCAGGCTCCTGCCAAGGCCGAGTTCGCAGAAGTACTGCGAAGC
GCAAGCGTCTTCTTCGACGGCATCGAGAGCGGTCTGATCTTCAGCGAGCTCGCCAGACTTCTGACTCAGGCACTT
GGCATGGGACACGGCAGCATGGCCGATCGAGCGGACAAGATCTCGCTCGTCAACTTCATCATCTCCAACTTTAAC
GTGCGCGAAGAAGAAATGGTCACTGTTCACGCACCTCTCACCTGCCTGGCTGCCCTGTCTCTGCTGGAAGACCTT
CGGACTCGCAGAGCAGAAAACGGTTTGACAGACGTCGAAACGGCCGAGTTGTCGGAACAATCGTTGAACGTAATC
GCATCAATGGTAGAGCTGGTACCGGACCGGGCTTTTCCAGTCGCCCGAAATGAGGCGCCGGGCTCCCGACCGGGA
TCGGGGGCGGCACTGTCCGTCTCCAACGCGGACATACTCAAAAAGATGGAGGCATTCTACGTCCATGAGCAGGGC
AACCTCGATTCTTGCCCGGCCCCCTTCAGCGCAGTCGAATCAGGAGAATTGCTGCTACAGAAAGCTGTCAAGTAC
ATTTGCGATGAGGACAGCGCGAGATGGAATCAGGATATGGGCGTGCGCGTGCGCGTCTTCGTTCTCGTTCTACTG
AAGACGCCGACATCTTATGAGTTTGACGTGGACAAGCCCATGTCCCACTTGAAGAGACACCTGCGACGGGATGGC
CGGCTGCCCTTCTCCTGCTTCTCGTCGGTGCTCCAGCTGGCCACGCAGCTCTATTCCGCCGAAAGGATCAGTGCG
ATGCAGCTGTCTGACCTGGTGGCGCCTCTGGTCGGCCACGCGTGGTCATACCTGTCGGCTTCCGACCCAAAATAC
CATGTAGAGACTGTCCGCTGTCTGTGGCAACTGCAGACTGCGCTCACGCCATGGAATCGCGAGATGGAGGCAGCC
ATCTCGAGCATCCTAGTAGCACGCCAGTCAAAAAGCCTCGGGGCCGCGAGCTTCGCCGAGGCAGCGCGCACTTTC
GGCGTCCTGTGGTCGCATACGCTCCAAGATACCGCTGCTGATCGCCGAGGCCCGAAGACGCCGACTCAGGAGCTC
AAGTCGTCTCCCCGACTGGCGGGCATGGATCATTACCAGGTCATGTTGACCCAGCCGCTTTTCCTCATCCTGGAC
TCGCTGCTCGATGAGCGAACACAGGTGTACATGGTTGTCAAGTCCTGGCTCAACAGCACGATCGGCATTGACAGA
CTCTTCCTCCTCTTCGTGGCCAAGTTGGCCGAAATTCCATGTCTATCGTCCGTCGGCACCAGAGGTGGCGGCGAA
AAAAGAGCCGATGCCGAGCCCATCGATTTCAACGAGGACGACGATTTGGATCTCTTCTTGTACTACCTGCGGACC
CTGCACCGTGTGCTTCGCTGCACCGAAGACGTGCCACGAGCGGTCCTGGCCTCGAGGTATCTCTACTTTGGCGGT
GGAGAGGTGCAAATCCGCGGGAGTGCCGAGGAGGGCGAGATGACTCTCCAAGACTATTTCGTTCGCGTATGCGTA
GAGTGTATCACGGCAGAGGTGGTGCCCACTGCTGGCGACGATGTGGTCGAGCGAGTCTCTCAACTCCGTCGATAT
GCGTTGACCATCCTCCACGAGTTTCTCTCGAGCCATCACGCTGTTCCGGTCACCCAGCTGCAGCTCGACAACATT
TTGTACGACAGGCTGGCCAAGTCCATCAGCACGCCAGACCCATACGTTCAGGTCCTGCTTCTCGATGTCATCCAC
GACACGCTCAAGCTCCAGGAGATGGCAGCTGGAGAGCGTCCCGCTACACCGGCACCCGAGAGAATGCCGCCGAGC
CTTGATCGGGCCCGAACCAGCCGAACGTCGCTCGCCATGAGCGACGGCGCGGCCAGCGGGCCGTCGATGCCTCCT
CAACTTCTCAAATGTCTGCAGGCCGGACTGAGCTCCACCAGCAGCCACTCGGTTCTGGACAGCTGGATAGGCTTT
CTGGGAGACCTGCTGCCGTTCTTTTCCCATGCGATCTTCCAAGCCTTGATACCGCTCGTCGAAACGCTGTGCAGG
CAGATCGCGGCGACGCTGTCCAGCCTCCGCGACACGTTCCAGGCGGATGCTCCACGGGCGTGCCCGGCCGGAAGC
CCGCCGGAATCCGCCTTGTTCTACCTGCTGAACGGTCTGGAGCGGGTGCTCGCCCTCGGCCACGACCAGCTTGTC
ACGGAAGAGAGCCAAGCGCGGCTGTTGAAGGGGCCCGAGCAGCCGCAGTCTCTCTTCGGGAGCATGGTGTCGGGC
GTGTTTCAATCGGACACGGCGCAGTCGCGGAGCTCGACGGCGAATGATCGCCTGACGGTCCACCTGGCCTTCCAG
GATACCATGCGCACATGCTACAAGATCTGGTCGTGGGGCCAGGGGGACGAGGCCAAGAAGCAGGACCCCGTCTCG
CTGGCGTCCTTCAACCACACGTCACTGCGGATGAGAAACCGGGCGCGACGGCTGCTCGAGCACCTCTTCGCCGCC
GAGACGCTCGAGTGTCTGGAGACGGTGATTGACATCTGGAAGTCGGCCGGCACAGCGGCCGAGCGCGCCCAAGTA
TTCAACTTTTTGTCGGCTCTGGACGCGTGCCGGCCCAAGCATTGCGTGCCAGCCCTCTTCAACTCCATCTACAGC
CGGACCAACCCGGGCGCCCTGGACCCGTCGCGGAAGTCGGCCATGACCATCTCTCTCCTGGATTCCGACCTGGTC
GTCTTCCTGGTCGAGTACGCGCGCTCCCTCGACGACGATGCGATGGACGAGATCTGGCAGGACTGCATGACCTTC
CTCCGGGACCTGCTGGGAAACCCGTTCCCGCACAGGCAGACGCTGCCGAGCCTGCTCGAGTTTGCGGCCATCCTG
GGCGAGAAGGTGGACAATACGAACTTTGGAGAGCAGCGGAGGATGCGTCGGGAGCTGGGGGATCTCTTCCTGCGC
CTCCTCGCAGCGCTCTTCACCACCCGTCCCATGACGTTTGCCGAGGCGAACGGTGCGACGGAGAGGTCCGGCAAG
GACAACACCGGTCGGCGGAGCACGCTGAGCAGCGCGGCCGAGGGGTCGGACAATGTGGTGTCCGTCTTGGCGTCG
ATTGTGCCCAAGCTGCCCAAGATTCTGCTGGAGAACGAGCGGGTGCTGTCGGCGGCGGCGACGATGTCGACGCAC
GTCATCGGGCCGGCGCTGCGGTCCAGGGCCTTCCCCGAGACGATGTCGCAGAAGGTGATGCGGCTGCTGGCGGAG
CTGTCGCGGCTGCCCAACAACCAGAAGACGTGGAAGAAGGACGTGGGCGACGCCTTTTACGACGGCAGGTTCTTC
GGCACGAGGCTGGAGCTGGTCGGGAGCGACTGGCTGCCGCTGCTGCGCCAGTGGGCGCTGACGGACAAGGAGCGG
ATGCCGGAGATGGTGGGGCGGATCAGCGCGCCGACAACGGCCGGCATCGTCTTCGGCGTGGGCGCGACGTCGGCC
CGGTTCGAGGCGGACCGGCGGACGCAGCTGGTGCTGCGGCGGATGGCGACGCTGGTGGCGGCGTCGGCCGAGGAC
GCCTTCGTGGCGGAGCTGCCGGCGATGCTGGACAAGCTGGTGGAGCTGCTGGCGGCGACGGCGACGTCGTCGCCG
TCGTCGACGACGCGGGCCGACCTGTTCCTGGTGGTGCGGGCGCTGGTGCTGAAGACGAGCGCGGTGCACCTGGCG
ATGCTGTGGCCGGTGCTGAACGCGGAGCTGCACGCGGTGCTGGCGTCGGCGGCGGCGCCCGAGCACAGCGCCGCG
TGGGAGACGTACGGCAACGCGGCGGTGCTGCAGGCGTGCAAGCTGCTGGACCTGCTCGTCTGCGTGGCGCCCGAC
GACTTTCAGCTGCACGAGTGGCTGTTCGTGACGGACACGGTCGACGCCGTCTACCGCTCGTCGGCCCACCAGCCC
GTCGCCCTGGTCGACGAGCTGTCGGAGGAGACGGCGGGCGCGGCGGCGGCGACGGCGGGGGCACGGACGGGCATT
GAACTGGCCCTTTGTCTGGCTTGGTGA
Gene >Hirsu2|9876
ATGGCCCTCGAGTCGGGGCCTGGCGCCCCCTCGGGGTCTCCCGAAAGCTCAGAACGCGACTCGCCCATCCCTCGA
CGCTGGAGGACCCAGCTTGGTGAAGGTTCGCGCTCCTAGAACCCGTCGTTGACGCGTCTTTCCCGACTAATGTCC
GGCGACAGATGAGCAGCCCATCAAGGACAAAGCATACCGCAAATATGCGTCCGGGGTCGAGAAGGCGCTGTCGCT
ATTCGAGACGGCTCTGGAGGAATGGGCAGACTACATATCCTTCCTGAACAAGCTTCTCAAGGTCTGCAATTGTCT
CCGCGGCCTGCAACAGCCACCTGACCTCCCTTCCCCAGGCTCTGCAAGCTCGGCCGACTTCCATCACGGCGATCC
CCACGAAAGCGACCGTCGCCAAACGCCTGTCCCAATGCCTCAACCCCGCGCTGCCGTCAGGCGTCCACCAGAAGG
CCCTCGAAGTTTACAATTACGTCTTCACCGTGATCGGGAGAGAGGGCTTGTCCCGCGACCTCCCGTTGTATCTGT
CCGGGCTCGCTCCCACGCTCTCCTTCGCCTCTCTCGCCGTTCGAGCGCCTTACCTGCATCTGTTGGAATCGCACT
TTCTCCAAATCGACCCGCGCTCTCTGAGACCGGCAATGAAGTCCATAATACTGGCGCTGCTACCAGGCTTGGAAG
ACGAGACGAGCGAGGACTTTGACCGCACCTTGAGCCTCGTCACGGGCTTCAAGAAGGCTGTCAGGCCTCAGGACA
GCGAAAAGCTCACCGAGAACCATGCCTCGGGCGACGACTTCTTCTGGCAATGCTTCTTCTTGGCATGCATCACCG
GCAACAGCCGCCGCTCCGGGGCCTTGGCATATTTGGTGCGCTATCTGCCGGTGCTGGGGCCCGTCCCGTCCGCAG
CCGGCTCTGATGCGGCGCCGCCCAACAAGGACGACGACGAAAACTCCAAAATCTGCCTCATGGTGACTTCTCCCG
AGCCCGGGCTGTTGGTCCGCTGCCTCGCCAGTGGCTTGGCTGACGATCAAATACTCATCCAACGCGGCTTTCTCG
ATCTCTTGGTGACGCACTTGCCCCTGAACTCGAGCGTGCTGCAATCTCGTGTGAAACCGGCCGATCTCGAGTTCC
TCCTGAGGGCTGCTGTCGGGGTGGTCACGAGACGAGACATGAGCCTGAACAGGCGGCTGTGGGCATGGCTCCTCG
GCCCCGAACCAACCGGCGGCGAAGGGGAACAGACCGATGACCAGCTAGCGTCCTCTCCCGGTCAACAGCAGGCGT
TCCTTTCGTCCAGGACCAGCTACTTCGAGGAATATGGCCTGCAGCCGCTGACGAGAACCCTGCTCGACATGATCA
GGGGCGCTGTCGGCGGAAACGCCGCAGAGCGAGCCCGGCCGTACAGGATCTGCCTGTCTCTGATGGACAGGTGGG
AGATCGGAGGCCTGATCGTATCTGAAGTCTTCCTGCCGGTCATCGAGAGTGTACGACAATTCCAGAGTCAGGCTC
CTGCCAAGGCCGAGTTCGCAGAAGTACTGCGAAGCGCAAGCGTCTTCTTCGACGGCATCGAGAGCGGTCTGATCT
TCAGCGAGCTCGCCAGACTTCTGACTCAGGCACTTGGCATGGGACACGGCAGCATGGCCGATCGAGCGGACAAGA
TCTCGCTCGTCAACTTCATCATCTCCAACTTTAACGTGCGCGAAGAAGAAATGGTCACTGTTCACGCACCTCTCA
CCTGCCTGGCTGCCCTGTCTCTGCTGGAAGACCTTCGGACTCGCAGAGCAGAAAACGGTTTGACAGACGTCGAAA
CGGCCGAGTTGTCGGAACAATCGTTGAACGTAATCGCATCAATGGTAGAGCTGGTACCGGACCGGGCTTTTCCAG
TCGCCCGAAATGAGGCGCCGGGCTCCCGACCGGGATCGGGGGCGGCACTGTCCGTCTCCAACGCGGACATACTCA
AAAAGATGGAGGCATTCTACGTCCATGAGCAGGGCAACCTCGATTCTTGCCCGGCCCCCTTCAGCGCAGTCGAAT
CAGGAGAATTGCTGCTACAGAAAGCTGTCAAGTACATTTGCGATGAGGACAGCGCGAGATGGAATCAGGATATGG
GCGTGCGCGTGCGCGTCTTCGTTCTCGTTCTACTGAAGACGCCGACATCTTATGAGTTTGACGTGGACAAGCCCA
TGTCCCACTTGAAGAGACACCTGCGACGGGATGGCCGGCTGCCCTTCTCCTGCTTCTCGTCGGTGCTCCAGCTGG
CCACGCAGCTCTATTCCGCCGAAAGGATCAGTGCGATGCAGCTGTCTGACCTGGTGGCGCCTCTGGTCGGCCACG
CGTGGTCATACCTGTCGGCTTCCGACCCAAAATACCATGTAGAGACTGTCCGCTGTCTGTGGCAACTGCAGACTG
CGCTCACGCCATGGAATCGCGAGATGGAGGCAGCCATCTCGAGCATCCTAGTAGCACGCCAGTCAAAAAGCCTCG
GGGCCGCGAGCTTCGCCGAGGCAGCGCGCACTTTCGGCGTCCTGTGGTCGCATACGCTCCAAGATACCGCTGCTG
ATCGCCGAGGCCCGAAGACGCCGACTCAGGAGCTCAAGTCGTCTCCCCGACTGGCGGGCATGGATCATTACCAGG
TCATGTTGACCCAGCCGCTTTTCCTCATCCTGGACTCGCTGCTCGATGAGCGAACACAGGTGTACATGGTTGTCA
AGTCCTGGCTCAACAGCACGATCGGCATTGACAGGTAACGAAACAATCGTCAGCTAAAAGATCATTCTGCTCACT
CAGCATCGCAGACTCTTCCTCCTCTTCGTGGCCAAGTTGGCCGAAATTCCATGTCTATCGTCCGTCGGCACCAGA
GGTGGCGGCGAAAAAAGAGCCGATGCCGAGCCCATCGATTTCAACGAGGACGACGATTTGGATCTCTTCTTGTAC
TACCTGCGGACCCTGCACCGTGTGCTTCGCTGCACCGAAGACGTGCCACGAGCGGTCCTGGCCTCGAGGTATCTC
TACTTTGGCGGTGGAGAGGTGCAAATCCGCGGTTCGTCGCCGCCCCTGATGCGCGAGACACGACGCGCTGCTAAC
GCTCTGTATCAGGGAGTGCCGAGGAGGGCGAGATGACTCTCCAAGACTATTTCGTTCGCGTATGCGTAGAGTGTA
TCACGGCAGAGGTGGTGCCCACTGCTGGCGACGATGTGGTCGAGCGAGTCTCTCAACTCCGTCGATATGCGTTGA
CCATCCTCCACGAGTTTCTCTCGAGCCATCACGCTGTTCCGGTCACCCAGCTGCAGCTCGACAACATTTTGTACG
ACAGGCTGGCCAAGTCCATCAGCACGCCAGACCCATACGTTCAGGTCCTGCTTCTCGATGTCATCCACGACACGC
TCAAGCTCCAGGAGATGGCAGCTGGAGAGCGTCCCGCTACACCGGCACCCGAGAGAATGCCGCCGAGCCTTGATC
GGGCCCGAACCAGCCGAACGTCGCTCGCCATGAGCGACGGCGCGGCCAGCGGGCCGTCGATGCCTCCTCAACTTC
TCAAATGTCTGCAGGCCGGACTGAGCTCCACCAGCAGCCACTCGGTTCTGGACAGCTGGATAGGCTTTCTGGGAG
ACCTGCTGCCGTTCTTTTCCCATGCGATCTTCCAAGCCTTGATACCGCTCGTCGAAACGCTGTGCAGGCAGATCG
CGGCGACGCTGTCCAGCCTCCGCGACACGTTCCAGGCGGATGCTCCACGGGCGTGCCCGGCCGGAAGCCCGCCGG
AATCCGCCTTGTTCTACCTGCTGAACGGTCTGGAGCGGGTGCTCGCCCTCGGCCACGACCAGCTTGTCACGGAAG
AGAGCCAAGCGCGGCTGTTGAAGGGGCCCGAGCAGCCGCAGTCTCTCTTCGGGAGCATGGTGTCGGGCGTGTTTC
AATCGGACACGGCGCAGTCGCGGAGCTCGACGGCGAATGATCGCCTGACGGTCCACCTGGCCTTCCAGGATACCA
TGCGCACATGCTACAAGATCTGGTCGTGGGGCCAGGGGGACGAGGCCAAGAAGCAGGACCCCGTCTCGCTGGCGT
CCTTCAACCACACGTCACTGCGGATGAGAAACCGGGCGCGACGGCTGCTCGAGCACCTCTTCGCCGCCGAGACGC
TCGAGTGTCTGGAGACGGTGATTGACATCTGGAAGTCGGCCGGCACAGCGGCCGAGCGCGCCCAAGTATTCAACT
TTTTGTCGGCTCTGGACGCGTGCCGGCCCAAGCATTGCGTGCCAGCCCTCTTCAACTCCATCTACAGCCGGACCA
ACCCGGGCGCCCTGGACCCGTCGCGGAAGTCGGCCATGACCATCTCTCTCCTGGATTCCGACCTGGTCGTCTTCC
TGGTCGAGTACGCGCGCTCCCTCGACGACGATGCGATGGACGAGATCTGGCAGGACTGCATGACCTTCCTCCGGG
ACCTGCTGGGAAACCCGTTCCCGCACAGGCAGACGCTGCCGAGCCTGCTCGAGTTTGCGGCCATCCTGGGCGAGA
AGGTGGACAATACGAACTTTGGAGAGCAGCGGAGGATGCGTCGGGAGCTGGGGGTGCGCGTCCTCCCCTTGGCCA
ACGGCCGTGATGTCCCCGTGCTGATTGGTGCTGACGACGGAACAATAGGATCTCTTCCTGCGCCTCCTCGCAGCG
CTCTTCACCACCCGTCCCATGACGTTTGCCGAGGCGAACGGTGCGACGGAGAGGTCCGGCAAGGACAACACCGGT
CGGCGGAGCACGCTGAGCAGCGCGGCCGAGGGGTCGGACAATGTGGTGTCCGTCTTGGCGTCGATTGTGCCCAAG
CTGCCCAAGATTCTGCTGGAGAACGAGCGGGTGCTGTCGGCGGCGGCGACGATGTCGACGCACGTCATCGGGCCG
GCGCTGCGGTCCAGGGCCTTCCCCGAGACGATGTCGCAGAAGGTGATGCGGCTGCTGGCGGAGCTGTCGCGGCTG
CCCAACAACCAGAAGACGTGGAAGAAGGACGTGGGCGACGCCTTTTACGACGGCAGGTTCTTCGGCACGAGGCTG
GAGCTGGTCGGGAGCGACTGGCTGCCGCTGCTGCGCCAGTGGGCGCTGACGGACAAGGAGCGGATGCCGGAGATG
GTGGGGCGGATCAGCGCGCCGACAACGGCCGGCATCGTCTTCGGCGTGGGCGCGACGTCGGCCCGGTTCGAGGCG
GACCGGCGGACGCAGCTGGTGCTGCGGCGGATGGCGACGCTGGTGGCGGCGTCGGCCGAGGACGCCTTCGTGGCG
GAGCTGCCGGCGATGCTGGACAAGCTGGTGGAGCTGCTGGCGGCGACGGCGACGTCGTCGCCGTCGTCGACGACG
CGGGCCGACCTGTTCCTGGTGGTGCGGGCGCTGGTGCTGAAGACGAGCGCGGTGCACCTGGCGATGCTGTGGCCG
GTGCTGAACGCGGAGCTGCACGCGGTGCTGGCGTCGGCGGCGGCGCCCGAGCACAGCGCCGCGTGGGAGACGTAC
GGCAACGCGGCGGTGCTGCAGGCGTGCAAGCTGCTGGACCTGCTCGTCTGCGTGGCGCCCGACGACTTTCAGCTG
CACGAGTGGCTGTTCGTGACGGACACGGTCGACGCCGTCTACCGCTCGTCGGCCCACCAGCCCGTCGCCCTGGTC
GACGAGCTGTCGGAGGAGACGGCGGGCGCGGCGGCGGCGACGGCGGGGGCACGGACGGGCATTGAACTGGCCCTT
TGTCTGGCTTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail