Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9869
Gene name
LocationContig_75:39017..42521
Strand+
Gene length (bp)3504
Transcript length (bp)3321
Coding sequence length (bp)3321
Protein length (aa) 1107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07928 Vps54 Vps54-like protein 9.9E-51 822 955

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14093|VPS54_SCHPO Vacuolar protein sorting-associated protein 54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps54 PE=1 SV=1 43 1025 3.0E-58
sp|F4JT76|VPS54_ARATH Vacuolar protein sorting-associated protein 54, chloroplastic OS=Arabidopsis thaliana GN=VPS54 PE=1 SV=1 200 1069 1.0E-48
sp|Q12071|VPS54_YEAST Vacuolar protein sorting-associated protein 54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS54 PE=1 SV=1 183 930 1.0E-45
sp|Q9JMK8|VPS54_RAT Vacuolar protein sorting-associated protein 54 OS=Rattus norvegicus GN=Vps54 PE=2 SV=1 663 1056 2.0E-26
sp|Q9P1Q0|VPS54_HUMAN Vacuolar protein sorting-associated protein 54 OS=Homo sapiens GN=VPS54 PE=1 SV=2 663 1056 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14093|VPS54_SCHPO Vacuolar protein sorting-associated protein 54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps54 PE=1 SV=1 43 1025 3.0E-58
sp|F4JT76|VPS54_ARATH Vacuolar protein sorting-associated protein 54, chloroplastic OS=Arabidopsis thaliana GN=VPS54 PE=1 SV=1 200 1069 1.0E-48
sp|Q12071|VPS54_YEAST Vacuolar protein sorting-associated protein 54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS54 PE=1 SV=1 183 930 1.0E-45
sp|Q9JMK8|VPS54_RAT Vacuolar protein sorting-associated protein 54 OS=Rattus norvegicus GN=Vps54 PE=2 SV=1 663 1056 2.0E-26
sp|Q9P1Q0|VPS54_HUMAN Vacuolar protein sorting-associated protein 54 OS=Homo sapiens GN=VPS54 PE=1 SV=2 663 1056 4.0E-26
sp|Q5SPW0|VPS54_MOUSE Vacuolar protein sorting-associated protein 54 OS=Mus musculus GN=Vps54 PE=1 SV=1 612 1056 5.0E-26
sp|Q22639|VPS54_CAEEL Vacuolar protein sorting-associated protein 54 OS=Caenorhabditis elegans GN=vps-54 PE=1 SV=2 704 1019 4.0E-20
sp|Q9VLC0|VPS54_DROME Vacuolar protein sorting-associated protein 54 OS=Drosophila melanogaster GN=scat PE=1 SV=1 704 1035 7.0E-16
sp|Q61JT8|VPS54_CAEBR Vacuolar protein sorting-associated protein 54 OS=Caenorhabditis briggsae GN=vps-54 PE=3 SV=1 704 1019 2.0E-15
sp|Q5SPW0|VPS54_MOUSE Vacuolar protein sorting-associated protein 54 OS=Mus musculus GN=Vps54 PE=1 SV=1 217 362 2.0E-07
sp|Q9JMK8|VPS54_RAT Vacuolar protein sorting-associated protein 54 OS=Rattus norvegicus GN=Vps54 PE=2 SV=1 217 362 3.0E-07
sp|Q9VLC0|VPS54_DROME Vacuolar protein sorting-associated protein 54 OS=Drosophila melanogaster GN=scat PE=1 SV=1 212 355 8.0E-07
sp|Q9P1Q0|VPS54_HUMAN Vacuolar protein sorting-associated protein 54 OS=Homo sapiens GN=VPS54 PE=1 SV=2 217 362 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0042147 retrograde transport, endosome to Golgi Yes
GO:0046907 intracellular transport No
GO:0016197 endosomal transport No
GO:0008150 biological_process No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0016192 vesicle-mediated transport No
GO:0016482 cytosolic transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9869
MFSSTDAGKSVDSLSVLSPGGRHEIPLHNNRPGQGLARPASRRNSTASSIHSAGGAPDSLGAGWSTLPPNFGQNA
ISTLLQPPIVRTGLQPHTTAPASSAYKPPTARDIPPVTLTNIPHVDPAEFTPYLTQVGPLYEQLKRLQESEDDSS
GARRWNRQEEAADSGTDGYLRPASRPFSSRQSSSASLASLSSVEQPSPMRRTSSGFVRKAQQGPPPLSTIPNVYF
DEDFHLENPRTFDVVSERSEVIQSPQPGHSDKMENSTSVKTPRKALATNAILQEKLSWYMDTIEVHLINSISTAS
TTFFTALGSLKELHLEASESVERIRALRTELEALDAEVAKNGLQIVQKRSRQANLKKLNDAVLQLQQIVDGVGHC
ESLVDAGEVDKALASIDSLERLIAGESQQAENGDGDEAPSQLRDLRSASALQGVNDDLSILRSRAGKAYESQFSS
ILIADLRQHVESAPSSEVLVRWSIAASRSRGGHSRSPSAFPAYLSATEDLKAQLLPIMGGLQRANHVALAAMAYR
EAVLRDIRNLIRRPLPSSNDDDNESMVSVSTSGGKPRSNQEKSSTLARNLRALGPEEAEEMLITIYVGVTETLRR
LTTQVKVLLDMASSLTEPEDGSKSPPVKSPVTSPRPERAGGKPAGGGFALQEELHKTLDEATLLTQAVDVAHDKV
AKILKVRSEQTTHLPLGLFLRYFSLNLGFANECEAISGRSGTQLKTVVNGQIKEFVQRNRDAEMQRLAQGMESDQ
WNAKDFTEKNKELLELILESSSRDDAAWTEGNEIWVPYQARGEAKKAETATGEVNGSAAAKDKTRAAMIESEKFV
LPQSAILCLEGVGNFLQLVAGIPSMTTEVASSLVAYLQLFNSRCTQLILGAGATRSAGLKNITTKHLALASQALG
FMAALVPHMREFMRGHGGSAAGVASLMGEFDKVRRQLQEHQESIHQKLVDIMSGRAAVHAKSVRATDWDAAKASE
GPHAYMETLTKETTTLHRVLTKHLPARSIQVIMQPVFQKYKDQLGAALKEAEAKTERGQQSMLRDVEFLSAKLGK
VDGFGDTGDFLADTVKAKEVKGPASAPTEERAGGEGEGEPKTNEGSESGPKEGEEE*
Coding >Hirsu2|9869
ATGTTTTCCTCGACCGATGCCGGCAAATCTGTCGACAGTCTCTCTGTTCTGTCTCCCGGCGGTCGGCACGAGATC
CCGCTACATAACAATCGGCCCGGCCAAGGCCTTGCCAGGCCGGCATCAAGACGCAACTCTACGGCAAGCTCCATA
CATTCTGCAGGGGGCGCCCCAGATTCCTTGGGCGCCGGCTGGTCGACACTGCCGCCGAATTTTGGACAGAATGCC
ATCTCCACACTACTACAACCGCCGATCGTACGGACGGGTCTCCAGCCTCACACCACGGCTCCCGCATCGAGCGCT
TACAAGCCGCCGACTGCCAGAGATATCCCGCCCGTCACGCTGACGAACATACCTCACGTCGACCCAGCCGAATTC
ACACCCTATCTGACCCAGGTCGGACCACTGTACGAGCAACTCAAGCGGTTACAGGAAAGCGAAGACGATAGCTCA
GGTGCTCGCCGGTGGAACAGGCAGGAGGAAGCGGCCGACTCAGGGACGGACGGGTACCTCCGACCAGCCTCGAGA
CCCTTCAGCAGCCGGCAGAGCTCCAGCGCATCCCTGGCATCTCTGAGCTCTGTGGAACAGCCCAGCCCTATGAGA
CGGACCAGCTCTGGTTTCGTGCGAAAAGCGCAACAAGGCCCCCCGCCCCTGTCGACCATCCCCAACGTTTACTTT
GACGAGGACTTTCATCTCGAGAATCCTCGCACGTTTGACGTCGTGAGCGAACGATCCGAGGTCATTCAGTCACCT
CAGCCGGGGCACTCGGACAAGATGGAGAACAGCACGAGTGTCAAGACGCCGAGGAAGGCTCTTGCCACCAACGCG
ATTCTCCAAGAAAAGCTTTCTTGGTACATGGACACGATTGAAGTGCACCTGATCAACTCGATATCGACGGCCTCG
ACCACCTTCTTCACTGCCTTGGGATCTCTCAAGGAACTCCACCTGGAGGCTTCCGAGTCGGTCGAAAGGATACGC
GCGCTCCGAACAGAGCTTGAGGCACTGGACGCGGAGGTGGCGAAGAACGGTCTGCAGATTGTGCAGAAGCGTTCG
CGACAAGCGAACTTGAAAAAGCTCAACGATGCCGTTCTCCAGCTGCAGCAGATCGTGGACGGCGTAGGCCACTGC
GAGTCGCTCGTTGACGCGGGGGAGGTAGACAAGGCGCTGGCGAGCATCGATTCGCTGGAAAGGCTGATTGCGGGC
GAGAGCCAGCAGGCGGAGAACGGGGACGGGGACGAAGCGCCGTCGCAACTGCGCGACCTACGGTCTGCGTCGGCG
CTCCAAGGCGTGAACGACGACCTTTCCATACTACGGTCTCGTGCCGGGAAGGCGTACGAGTCGCAATTCTCCAGC
ATCCTGATTGCCGACTTGCGACAGCACGTCGAGTCGGCGCCCAGCTCGGAAGTTCTCGTCCGGTGGAGCATCGCG
GCTTCGAGGTCGAGGGGCGGCCATTCCCGGTCTCCTTCGGCGTTTCCCGCGTATCTCAGCGCGACGGAAGATCTC
AAGGCACAGCTACTGCCGATCATGGGAGGACTGCAGCGCGCCAATCACGTCGCCCTGGCGGCCATGGCCTACCGC
GAGGCGGTGCTGCGGGACATCCGAAACCTGATCCGACGGCCGCTGCCCAGCTCCAACGACGACGACAACGAGTCG
ATGGTGTCGGTGTCGACGAGCGGAGGCAAGCCGAGATCGAACCAGGAGAAGTCGTCGACGCTGGCACGAAACCTG
CGGGCACTGGGGCCGGAGGAGGCGGAGGAGATGCTCATCACGATATACGTTGGCGTGACGGAGACGCTGAGGCGA
CTGACGACGCAGGTCAAGGTGCTGCTGGACATGGCCAGCTCGCTGACGGAGCCGGAGGACGGGTCCAAGTCGCCT
CCGGTCAAGTCGCCGGTGACCAGCCCCCGTCCGGAGCGGGCGGGAGGCAAGCCGGCGGGCGGGGGATTCGCGCTA
CAGGAAGAGCTGCACAAGACGCTGGACGAGGCGACATTGCTGACGCAGGCGGTCGACGTCGCGCACGACAAGGTG
GCCAAGATCCTCAAGGTGCGGTCGGAGCAGACGACGCACCTCCCGCTCGGCCTCTTCCTACGCTACTTCAGCCTC
AACCTGGGCTTCGCCAACGAGTGCGAGGCGATCTCGGGCCGGAGCGGGACGCAGCTAAAGACGGTGGTGAACGGG
CAGATCAAGGAGTTTGTGCAGCGGAACCGCGACGCAGAAATGCAGAGGCTCGCGCAAGGCATGGAATCGGACCAG
TGGAACGCCAAGGACTTTACGGAGAAGAACAAGGAGCTGCTGGAGCTCATCCTGGAGTCGAGCAGCCGAGACGAC
GCGGCGTGGACGGAGGGCAACGAGATCTGGGTGCCGTACCAGGCGAGGGGAGAGGCGAAGAAGGCGGAGACGGCG
ACGGGCGAGGTCAACGGCAGCGCGGCGGCCAAGGACAAGACGCGAGCGGCGATGATCGAGTCGGAGAAGTTTGTG
CTGCCGCAGTCGGCCATCCTTTGCCTGGAAGGGGTGGGCAACTTCTTGCAGCTGGTGGCGGGGATCCCGTCGATG
ACGACGGAGGTGGCGTCGTCGCTGGTGGCCTATCTACAGCTCTTCAACTCGCGCTGCACGCAGCTGATCCTGGGG
GCGGGGGCGACGCGGTCGGCCGGGCTGAAGAACATCACGACGAAACACCTGGCACTGGCGTCGCAGGCGCTCGGC
TTCATGGCGGCCTTGGTGCCTCACATGCGCGAGTTCATGCGCGGGCACGGCGGGAGCGCGGCCGGGGTGGCGAGC
CTGATGGGCGAGTTCGACAAGGTGCGGCGGCAGCTGCAGGAGCACCAGGAGAGCATCCACCAAAAGCTGGTGGAC
ATTATGAGCGGGCGGGCGGCGGTGCACGCGAAGAGCGTGAGGGCCACGGACTGGGACGCGGCGAAGGCGTCGGAG
GGCCCGCACGCGTACATGGAGACGCTGACGAAGGAGACGACGACGCTGCACCGGGTGCTGACGAAACACCTACCG
GCCAGGTCGATCCAGGTCATCATGCAGCCCGTCTTCCAGAAGTACAAGGACCAGCTCGGGGCGGCGCTCAAGGAG
GCCGAGGCCAAGACGGAGCGCGGGCAGCAGAGCATGCTCCGCGACGTGGAATTCCTGTCGGCCAAGCTCGGCAAG
GTGGACGGATTCGGGGACACGGGCGACTTTCTCGCCGACACGGTCAAGGCCAAGGAGGTGAAGGGCCCGGCGTCG
GCCCCGACGGAGGAGCGGGCCGGCGGCGAGGGCGAGGGCGAACCAAAGACAAACGAGGGCAGCGAGTCGGGGCCG
AAGGAAGGGGAGGAGGAGTGA
Transcript >Hirsu2|9869
ATGTTTTCCTCGACCGATGCCGGCAAATCTGTCGACAGTCTCTCTGTTCTGTCTCCCGGCGGTCGGCACGAGATC
CCGCTACATAACAATCGGCCCGGCCAAGGCCTTGCCAGGCCGGCATCAAGACGCAACTCTACGGCAAGCTCCATA
CATTCTGCAGGGGGCGCCCCAGATTCCTTGGGCGCCGGCTGGTCGACACTGCCGCCGAATTTTGGACAGAATGCC
ATCTCCACACTACTACAACCGCCGATCGTACGGACGGGTCTCCAGCCTCACACCACGGCTCCCGCATCGAGCGCT
TACAAGCCGCCGACTGCCAGAGATATCCCGCCCGTCACGCTGACGAACATACCTCACGTCGACCCAGCCGAATTC
ACACCCTATCTGACCCAGGTCGGACCACTGTACGAGCAACTCAAGCGGTTACAGGAAAGCGAAGACGATAGCTCA
GGTGCTCGCCGGTGGAACAGGCAGGAGGAAGCGGCCGACTCAGGGACGGACGGGTACCTCCGACCAGCCTCGAGA
CCCTTCAGCAGCCGGCAGAGCTCCAGCGCATCCCTGGCATCTCTGAGCTCTGTGGAACAGCCCAGCCCTATGAGA
CGGACCAGCTCTGGTTTCGTGCGAAAAGCGCAACAAGGCCCCCCGCCCCTGTCGACCATCCCCAACGTTTACTTT
GACGAGGACTTTCATCTCGAGAATCCTCGCACGTTTGACGTCGTGAGCGAACGATCCGAGGTCATTCAGTCACCT
CAGCCGGGGCACTCGGACAAGATGGAGAACAGCACGAGTGTCAAGACGCCGAGGAAGGCTCTTGCCACCAACGCG
ATTCTCCAAGAAAAGCTTTCTTGGTACATGGACACGATTGAAGTGCACCTGATCAACTCGATATCGACGGCCTCG
ACCACCTTCTTCACTGCCTTGGGATCTCTCAAGGAACTCCACCTGGAGGCTTCCGAGTCGGTCGAAAGGATACGC
GCGCTCCGAACAGAGCTTGAGGCACTGGACGCGGAGGTGGCGAAGAACGGTCTGCAGATTGTGCAGAAGCGTTCG
CGACAAGCGAACTTGAAAAAGCTCAACGATGCCGTTCTCCAGCTGCAGCAGATCGTGGACGGCGTAGGCCACTGC
GAGTCGCTCGTTGACGCGGGGGAGGTAGACAAGGCGCTGGCGAGCATCGATTCGCTGGAAAGGCTGATTGCGGGC
GAGAGCCAGCAGGCGGAGAACGGGGACGGGGACGAAGCGCCGTCGCAACTGCGCGACCTACGGTCTGCGTCGGCG
CTCCAAGGCGTGAACGACGACCTTTCCATACTACGGTCTCGTGCCGGGAAGGCGTACGAGTCGCAATTCTCCAGC
ATCCTGATTGCCGACTTGCGACAGCACGTCGAGTCGGCGCCCAGCTCGGAAGTTCTCGTCCGGTGGAGCATCGCG
GCTTCGAGGTCGAGGGGCGGCCATTCCCGGTCTCCTTCGGCGTTTCCCGCGTATCTCAGCGCGACGGAAGATCTC
AAGGCACAGCTACTGCCGATCATGGGAGGACTGCAGCGCGCCAATCACGTCGCCCTGGCGGCCATGGCCTACCGC
GAGGCGGTGCTGCGGGACATCCGAAACCTGATCCGACGGCCGCTGCCCAGCTCCAACGACGACGACAACGAGTCG
ATGGTGTCGGTGTCGACGAGCGGAGGCAAGCCGAGATCGAACCAGGAGAAGTCGTCGACGCTGGCACGAAACCTG
CGGGCACTGGGGCCGGAGGAGGCGGAGGAGATGCTCATCACGATATACGTTGGCGTGACGGAGACGCTGAGGCGA
CTGACGACGCAGGTCAAGGTGCTGCTGGACATGGCCAGCTCGCTGACGGAGCCGGAGGACGGGTCCAAGTCGCCT
CCGGTCAAGTCGCCGGTGACCAGCCCCCGTCCGGAGCGGGCGGGAGGCAAGCCGGCGGGCGGGGGATTCGCGCTA
CAGGAAGAGCTGCACAAGACGCTGGACGAGGCGACATTGCTGACGCAGGCGGTCGACGTCGCGCACGACAAGGTG
GCCAAGATCCTCAAGGTGCGGTCGGAGCAGACGACGCACCTCCCGCTCGGCCTCTTCCTACGCTACTTCAGCCTC
AACCTGGGCTTCGCCAACGAGTGCGAGGCGATCTCGGGCCGGAGCGGGACGCAGCTAAAGACGGTGGTGAACGGG
CAGATCAAGGAGTTTGTGCAGCGGAACCGCGACGCAGAAATGCAGAGGCTCGCGCAAGGCATGGAATCGGACCAG
TGGAACGCCAAGGACTTTACGGAGAAGAACAAGGAGCTGCTGGAGCTCATCCTGGAGTCGAGCAGCCGAGACGAC
GCGGCGTGGACGGAGGGCAACGAGATCTGGGTGCCGTACCAGGCGAGGGGAGAGGCGAAGAAGGCGGAGACGGCG
ACGGGCGAGGTCAACGGCAGCGCGGCGGCCAAGGACAAGACGCGAGCGGCGATGATCGAGTCGGAGAAGTTTGTG
CTGCCGCAGTCGGCCATCCTTTGCCTGGAAGGGGTGGGCAACTTCTTGCAGCTGGTGGCGGGGATCCCGTCGATG
ACGACGGAGGTGGCGTCGTCGCTGGTGGCCTATCTACAGCTCTTCAACTCGCGCTGCACGCAGCTGATCCTGGGG
GCGGGGGCGACGCGGTCGGCCGGGCTGAAGAACATCACGACGAAACACCTGGCACTGGCGTCGCAGGCGCTCGGC
TTCATGGCGGCCTTGGTGCCTCACATGCGCGAGTTCATGCGCGGGCACGGCGGGAGCGCGGCCGGGGTGGCGAGC
CTGATGGGCGAGTTCGACAAGGTGCGGCGGCAGCTGCAGGAGCACCAGGAGAGCATCCACCAAAAGCTGGTGGAC
ATTATGAGCGGGCGGGCGGCGGTGCACGCGAAGAGCGTGAGGGCCACGGACTGGGACGCGGCGAAGGCGTCGGAG
GGCCCGCACGCGTACATGGAGACGCTGACGAAGGAGACGACGACGCTGCACCGGGTGCTGACGAAACACCTACCG
GCCAGGTCGATCCAGGTCATCATGCAGCCCGTCTTCCAGAAGTACAAGGACCAGCTCGGGGCGGCGCTCAAGGAG
GCCGAGGCCAAGACGGAGCGCGGGCAGCAGAGCATGCTCCGCGACGTGGAATTCCTGTCGGCCAAGCTCGGCAAG
GTGGACGGATTCGGGGACACGGGCGACTTTCTCGCCGACACGGTCAAGGCCAAGGAGGTGAAGGGCCCGGCGTCG
GCCCCGACGGAGGAGCGGGCCGGCGGCGAGGGCGAGGGCGAACCAAAGACAAACGAGGGCAGCGAGTCGGGGCCG
AAGGAAGGGGAGGAGGAGTGA
Gene >Hirsu2|9869
ATGTTTTCCTCGACCGATGCCGGCAAATCTGTCGACAGTCTCTCTGTTCTGTCTCCCGGCGGTCGGCACGAGATC
CCGCTACATAAGTTTGTCGCGACAACAGACTCCGTCCCCCGTTCAGCGCTGACAGGAGGGAAAGCAATCGGCCCG
GCCAAGGCCTTGCCAGGCCGGCATCAAGACGCAACTCTACGGCAAGCTCCATACATTCTGCAGGGGGCGCCCCAG
ATTCCTTGGGCGCCGGCTGGTCGACACTGCCGCCGAATTTTGGACAGAATGGTTCGTTTCTACCGCCTCGGCTCG
TGACGGCGAGATGTCGCTCCTCTAACTTGGGAAAATAGCCATCTCCACACTACTACAACCGCCGATCGTACGGAC
GGGTCTCCAGCCTCACACCACGGCTCCCGCATCGAGCGCTTACAAGCCGCCGACTGCCAGAGATATCCCGCCCGT
CACGCTGACGAACATACCTCACGTCGACCCAGCCGAATTCACACCCTATCTGACCCAGGTCGGACCACTGTACGA
GCAACTCAAGCGGTTACAGGAAAGCGAAGACGATAGCTCAGGTGCTCGCCGGTGGAACAGGCAGGAGGAAGCGGC
CGACTCAGGGACGGACGGGTACCTCCGACCAGCCTCGAGACCCTTCAGCAGCCGGCAGAGCTCCAGCGCATCCCT
GGCATCTCTGAGCTCTGTGGAACAGCCCAGCCCTATGAGACGGACCAGCTCTGGTTTCGTGCGAAAAGCGCAACA
AGGCCCCCCGCCCCTGTCGACCATCCCCAACGTTTACTTTGACGAGGACTTTCATCTCGAGAATCCTCGCACGTT
TGACGTCGTGAGCGAACGATCCGAGGTCATTCAGTCACCTCAGCCGGGGCACTCGGACAAGATGGAGAACAGCAC
GAGTGTCAAGACGCCGAGGAAGGCTCTTGCCACCAACGCGATTCTCCAAGAAAAGCTTTCTTGGTACATGGACAC
GATTGAAGTGCACCTGATCAACTCGATATCGACGGCCTCGACCACCTTCTTCACTGCCTTGGGATCTCTCAAGGA
ACTCCACCTGGAGGCTTCCGAGTCGGTCGAAAGGATACGCGCGCTCCGAACAGAGCTTGAGGCACTGGACGCGGA
GGTGGCGAAGAACGGTCTGCAGATTGTGCAGAAGCGTTCGCGACAAGCGAACTTGAAAAAGCTCAACGATGCCGT
TCTCCAGCTGCAGCAGATCGTGGACGGCGTAGGCCACTGCGAGTCGCTCGTTGACGCGGGGGAGGTAGACAAGGC
GCTGGCGAGCATCGATTCGCTGGAAAGGCTGATTGCGGGCGAGAGCCAGCAGGCGGAGAACGGGGACGGGGACGA
AGCGCCGTCGCAACTGCGCGACCTACGGTCTGCGTCGGCGCTCCAAGGCGTGAACGACGACCTTTCCATACTACG
GTCTCGTGCCGGGAAGGCGTACGAGTCGCAATTCTCCAGCATCCTGATTGCCGACTTGCGACAGCACGTCGAGTC
GGCGCCCAGCTCGGAAGTTCTCGTCCGGTGGAGCATCGCGGCTTCGAGGTCGAGGGGCGGCCATTCCCGGTCTCC
TTCGGCGTTTCCCGCGTATCTCAGCGCGACGGAAGATCTCAAGGCACAGCTACTGCCGATCATGGGAGGACTGCA
GCGCGCCAATCACGTCGCCCTGGCGGCCATGGCCTACCGCGAGGCGGTGCTGCGGGACATCCGAAACCTGATCCG
ACGGCCGCTGCCCAGCTCCAACGACGACGACAACGAGTCGATGGTGTCGGTGTCGACGAGCGGAGGCAAGCCGAG
ATCGAACCAGGAGAAGTCGTCGACGCTGGCACGAAACCTGCGGGCACTGGGGCCGGAGGAGGCGGAGGAGATGCT
CATCACGATATACGTTGGCGTGACGGAGACGCTGAGGCGACTGACGACGCAGGTCAAGGTGCTGCTGGACATGGC
CAGCTCGCTGACGGAGCCGGAGGACGGGTCCAAGTCGCCTCCGGTCAAGTCGCCGGTGACCAGCCCCCGTCCGGA
GCGGGCGGGAGGCAAGCCGGCGGGCGGGGGATTCGCGCTACAGGAAGAGCTGCACAAGACGCTGGACGAGGCGAC
ATTGCTGACGCAGGCGGTCGACGTCGCGCACGACAAGGTGGCCAAGATCCTCAAGGTGCGGTCGGAGCAGACGAC
GCACCTCCCGCTCGGCCTCTTCCTACGCTACTTCAGCCTCAACCTGGGCTTCGCCAACGAGTGCGAGGCGATCTC
GGGCCGGAGCGGGACGCAGCTAAAGACGGTGGTGAACGGGCAGATCAAGGAGTTTGTGCAGCGGAACCGCGACGC
AGAAATGCAGAGGCTCGCGCAAGGCATGGAATCGGACCAGTGGAACGCCAAGGACTTTACGGAGAAGAACAAGGA
GCTGCTGGAGCTCATCCTGGAGTCGAGCAGCCGAGACGACGCGGCGTGGACGGAGGGCAACGAGATCTGGGTGCC
GTACCAGGCGAGGGGAGAGGCGAAGAAGGCGGAGACGGCGACGGGCGAGGTCAACGGCAGCGCGGCGGCCAAGGA
CAAGACGCGAGCGGCGATGATCGAGTCGGAGAAGTTTGTGCTGCCGCAGTCGGCCATCCTTTGCCTGGAAGGGGT
GGGCAACTTCTTGCAGCTGGTGGCGGGGATCCCGTCGATGACGACGGAGGTGGCGTCGTCGCTGGTGGCCTATCT
ACAGCTCTTCAACTCGCGCTGCACGCAGCTGATCCTGGGGGCGGGGGCGACGCGGTCGGCCGGGCTGAAGAACAT
CACGACGAAACACCTGGCACTGGCGTCGCAGGCGCTCGGCTTCATGGCGGCCTTGGTGCCTCACATGCGCGAGTT
CATGCGCGGGCACGGCGGGAGCGCGGCCGGGGTGGCGAGCCTGATGGGCGAGTTCGACAAGGTGCGGCGGCAGCT
GCAGGAGCACCAGGAGAGCATCCACCAAAAGCTGGTGGACATTATGAGCGGGCGGGCGGCGGTGCACGCGAAGAG
CGTGAGGGCCACGGACTGGGACGCGGCGAAGGCGTCGGAGGGCCCGCACGCGTACATGGAGACGCTGACGAAGGA
GACGACGACGCTGCACCGGGTGCTGACGAAACACCTACCGGCCAGGTCGATCCAGGTCATCATGCAGCCCGTCTT
CCAGAAGTACAAGGACCAGCTCGGGGCGGCGCTCAAGGAGGCCGAGGCCAAGACGGAGCGCGGGCAGCAGAGGTA
AGAGAGAGAGAGAGATGTGTGTATGATGGATGGCGCAGACGAGGATGAACTGACGACGGCCTTAGCATGCTCCGC
GACGTGGAATTCCTGTCGGCCAAGCTCGGCAAGGTGGACGGATTCGGGGACACGGGCGACTTTCTCGCCGACACG
GTCAAGGCCAAGGAGGTGAAGGGCCCGGCGTCGGCCCCGACGGAGGAGCGGGCCGGCGGCGAGGGCGAGGGCGAA
CCAAAGACAAACGAGGGCAGCGAGTCGGGGCCGAAGGAAGGGGAGGAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail