Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9850
Gene name
LocationContig_749:1057..2447
Strand+
Gene length (bp)1390
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 4.8E-20 126 358
PF10340 Say1_Mug180 Steryl acetyl hydrolase 1.8E-07 121 328

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P18773|EST_ACILW Esterase OS=Acinetobacter lwoffii GN=est PE=3 SV=2 116 347 7.0E-09
sp|Q7M370|AAAD_RABIT Arylacetamide deacetylase OS=Oryctolagus cuniculus GN=AADAC PE=1 SV=1 126 286 5.0E-07

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9850
MAASNKPSLSVREKLRLAIRLLTIIPLFFVVYTVRSGFFALRNGLPLRPHMGCAVGRILLRRFSAREAQYVMPTT
AQAYEAWTRRKVSRAESGADRERLKTRVQPLDSADAVIMWIGDRERASKLVLFLHGGGYKTPAFKAQIEWCWNSF
VQAGAEAGVEVAVGLLDYSLAPEARFPVQLRQAVAALGALLEAGVRPADIFLGGDSAGANLTVQLLGHLLHPHPD
VRQIALGEPLAGAFVVSPWVSCNKNRKSYGDHGWHDMLARDVIVFVAEEYFGGPRQLDEVLAGGNPWAFPLDADG
AGTWFQGADGLVSSFLVTFGRAECFADESRELATLFRSSHPTWDLRVDEADGEAHVFALAEHFVGEIGVATRRIK
HWFSFVITAKPMPGDATR*
Coding >Hirsu2|9850
ATGGCCGCGTCGAACAAGCCCTCGCTCTCCGTGCGCGAGAAGCTCAGGCTGGCTATCCGACTGCTGACCATCATC
CCCTTGTTCTTTGTCGTCTACACCGTCCGCTCCGGCTTCTTCGCGCTCCGTAATGGCCTACCGCTCCGGCCTCAC
ATGGGGTGCGCCGTGGGGCGGATATTACTGCGCCGCTTTTCCGCCCGGGAGGCCCAATATGTCATGCCGACGACG
GCACAAGCTTACGAGGCCTGGACGCGGCGGAAGGTCAGCCGGGCTGAGAGTGGCGCGGACCGGGAGAGACTGAAG
ACGCGGGTCCAGCCTCTGGACTCGGCCGACGCTGTCATAATGTGGATCGGCGACCGCGAAAGGGCCTCCAAGCTC
GTCCTCTTCCTCCACGGCGGAGGCTACAAAACGCCCGCCTTCAAGGCCCAAATCGAGTGGTGTTGGAACTCGTTC
GTCCAGGCCGGGGCCGAGGCCGGGGTCGAGGTCGCCGTCGGCCTCTTGGACTACTCGCTGGCCCCTGAGGCCCGC
TTCCCCGTCCAGCTGCGCCAGGCGGTCGCCGCTCTGGGCGCCCTCCTCGAGGCCGGCGTGCGGCCCGCCGACATC
TTCCTCGGTGGAGACTCGGCCGGCGCAAACCTGACTGTCCAGCTCCTCGGCCACCTCCTCCACCCGCACCCGGAC
GTCCGCCAGATCGCGCTCGGGGAGCCGCTAGCCGGCGCCTTCGTCGTCTCGCCCTGGGTCAGCTGCAACAAGAAC
CGCAAGTCGTACGGCGATCACGGCTGGCACGACATGCTGGCGCGCGACGTCATCGTCTTCGTCGCCGAGGAGTAC
TTCGGCGGGCCACGCCAGTTGGACGAGGTCCTGGCCGGCGGCAACCCCTGGGCCTTCCCGCTCGATGCCGACGGC
GCTGGCACCTGGTTCCAGGGCGCCGACGGCCTGGTCTCGAGCTTCCTCGTCACCTTTGGCCGCGCCGAGTGCTTC
GCCGACGAGAGCCGCGAGCTGGCTACGCTTTTCAGGAGCTCGCACCCGACCTGGGACCTACGTGTCGACGAGGCC
GACGGGGAGGCCCACGTCTTCGCCTTGGCGGAGCACTTCGTGGGCGAGATCGGAGTGGCGACCAGAAGGATAAAG
CACTGGTTCTCGTTCGTCATCACGGCCAAACCGATGCCAGGGGACGCAACCAGGTGA
Transcript >Hirsu2|9850
ATGGCCGCGTCGAACAAGCCCTCGCTCTCCGTGCGCGAGAAGCTCAGGCTGGCTATCCGACTGCTGACCATCATC
CCCTTGTTCTTTGTCGTCTACACCGTCCGCTCCGGCTTCTTCGCGCTCCGTAATGGCCTACCGCTCCGGCCTCAC
ATGGGGTGCGCCGTGGGGCGGATATTACTGCGCCGCTTTTCCGCCCGGGAGGCCCAATATGTCATGCCGACGACG
GCACAAGCTTACGAGGCCTGGACGCGGCGGAAGGTCAGCCGGGCTGAGAGTGGCGCGGACCGGGAGAGACTGAAG
ACGCGGGTCCAGCCTCTGGACTCGGCCGACGCTGTCATAATGTGGATCGGCGACCGCGAAAGGGCCTCCAAGCTC
GTCCTCTTCCTCCACGGCGGAGGCTACAAAACGCCCGCCTTCAAGGCCCAAATCGAGTGGTGTTGGAACTCGTTC
GTCCAGGCCGGGGCCGAGGCCGGGGTCGAGGTCGCCGTCGGCCTCTTGGACTACTCGCTGGCCCCTGAGGCCCGC
TTCCCCGTCCAGCTGCGCCAGGCGGTCGCCGCTCTGGGCGCCCTCCTCGAGGCCGGCGTGCGGCCCGCCGACATC
TTCCTCGGTGGAGACTCGGCCGGCGCAAACCTGACTGTCCAGCTCCTCGGCCACCTCCTCCACCCGCACCCGGAC
GTCCGCCAGATCGCGCTCGGGGAGCCGCTAGCCGGCGCCTTCGTCGTCTCGCCCTGGGTCAGCTGCAACAAGAAC
CGCAAGTCGTACGGCGATCACGGCTGGCACGACATGCTGGCGCGCGACGTCATCGTCTTCGTCGCCGAGGAGTAC
TTCGGCGGGCCACGCCAGTTGGACGAGGTCCTGGCCGGCGGCAACCCCTGGGCCTTCCCGCTCGATGCCGACGGC
GCTGGCACCTGGTTCCAGGGCGCCGACGGCCTGGTCTCGAGCTTCCTCGTCACCTTTGGCCGCGCCGAGTGCTTC
GCCGACGAGAGCCGCGAGCTGGCTACGCTTTTCAGGAGCTCGCACCCGACCTGGGACCTACGTGTCGACGAGGCC
GACGGGGAGGCCCACGTCTTCGCCTTGGCGGAGCACTTCGTGGGCGAGATCGGAGTGGCGACCAGAAGGATAAAG
CACTGGTTCTCGTTCGTCATCACGGCCAAACCGATGCCAGGGGACGCAACCAGGTGA
Gene >Hirsu2|9850
ATGGTATATACTCCACAGGGCGCGACCGATGCCTCTTCCACCCCTTCCCTCGGGCTGGCTGTCAACAATGCACAT
ATTCCGGGGCTTCAGGCTCAACCGGGAGCGAAGAGATTGCGGAGCTGATGCGGAACCGAACCCAGGCCGCGTCGA
ACAAGCCCTCGCTCTCCGTGCGCGAGAAGCTCAGGCTGGCTATCCGACTGCTGACCATCAGTAAGGAGTTGCACC
CGGCGCCGGCCCAAACTTACCATCGTCATTGCCGGCTGATGTCGTGAAATGGGCAGTCCCCTTGTTCTTTGTCGT
CTACACCGTCCGCTCCGGCTTCTTCGCGCTCCGTAATGGCCTACCGCTCCGGCCTCACATGGGGTGCGCCGTGGG
GCGGATATTACTGCGCCGCTTTTCCGCCCGGGAGGCCCAATATGTCATGCCGACGACGGCACAAGCTTACGAGGC
CTGGACGCGGCGGAAGGTCAGCCGGGCTGAGAGTGGCGCGGACCGGGAGAGACTGAAGACGCGGGTCCAGCCTCT
GGACTCGGCCGACGCTGTCATAATGTGGATCGGCGACCGCGAAAGGGCCTCCAAGCTCGTCCTCTTCCTCCACGG
CGGAGGCTACAAAACGCCCGCCTTCAAGGCCCAAATCGAGTGGTGTTGGAACTCGTTCGTCCAGGCCGGGGCCGA
GGCCGGGGTCGAGGTCGCCGTCGGCCTCTTGGACTACTCGCTGGCCCCTGAGGCCCGCTTCCCCGTCCAGCTGCG
CCAGGCGGTCGCCGCTCTGGGCGCCCTCCTCGAGGCCGGCGTGCGGCCCGCCGACATCTTCCTCGGTGGAGACTC
GGCCGGCGCAAACCTGACTGTCCAGCTCCTCGGCCACCTCCTCCACCCGCACCCGGACGTCCGCCAGATCGCGCT
CGGGGAGCCGCTAGCCGGCGCCTTCGTCGTCTCGCCCTGGGTCAGCTGCAACAAGAACCGCAAGTCGTACGGCGA
TCACGGCTGGCACGACATGCTGGCGCGCGACGTCATCGTCTTCGTCGCCGAGGAGTACTTCGGCGGGCCACGCCA
GTTGGACGAGGTCCTGGCCGGCGGCAACCCCTGGGCCTTCCCGCTCGATGCCGACGGCGCTGGCACCTGGTTCCA
GGGCGCCGACGGCCTGGTCTCGAGCTTCCTCGTCACCTTTGGCCGCGCCGAGTGCTTCGCCGACGAGAGCCGCGA
GCTGGCTACGCTTTTCAGGAGCTCGCACCCGACCTGGGACCTACGTGTCGACGAGGCCGACGGGGAGGCCCACGT
CTTCGCCTTGGCGGAGCACTTCGTGGGCGAGATCGGAGTGGCGACCAGAAGGATAAAGCACTGGTTCTCGTTCGT
CATCACGGCCAAACCGATGCCAGGGGACGCAACCAGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail