Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9848
Gene name
LocationContig_748:8593..9745
Strand-
Gene length (bp)1152
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10329 DUF2417 Region of unknown function (DUF2417) 2.5E-24 35 110

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13912|YDW6_SCHPO Uncharacterized protein C23C11.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C11.06c PE=4 SV=1 63 382 7.0E-60
sp|A6ZRW8|YNL5_YEAS7 Uncharacterized vacuolar membrane protein SCY_4679 OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_4679 PE=3 SV=1 48 381 4.0E-30
sp|P53925|YNL5_YEAST Uncharacterized vacuolar membrane protein YNL115C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL115C PE=1 SV=1 48 381 6.0E-30

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 57 79 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9848
MDRLLCQRRRRRRRRRRLRRRRRRRRRRREGRPGRGKEEEEERLTGRAETRRTLAEWLAVLLSTIAYAVMTVAVA
LITLTIILRALDAGVAPPGKLYAVDGGKYRVHVYCSGNRSEPRRDGGDDDDARQPTVLFEAGERPVEEDLWPLAD
NAVRNGSIARYCFVDRPGMAWSDAAPSPLSAGFAVDALSEALAQAGERGPWVLASAGIGSIYSRVFSARHGHEVR
GLLLIDPLHEDLLGRVAAPGRGFLLWLRGVISPLGLDRLSGAIFRGRTSRDRIYGRAWQQGSKAIYARLQESLVA
DSFTLRDVQGSRRIQDRRTPLVVVSSGLEVRDSPTWKDKQRDLTRLTDNLRHWDVVDGAPHLVWDTLDGRDQIET
RLRQLVHA*
Coding >Hirsu2|9848
ATGGATCGCCTCCTCTGCCAGAGACGGAGACGGAGGCGGAGGCGGAGGCGGTTGCGGCGGAGGCGGCGGCGGAGG
AGGCGGCGGCGGGAGGGGAGGCCGGGTCGGGGCAAGGAGGAGGAGGAGGAGCGGCTGACGGGCCGGGCCGAGACG
AGGCGCACCCTGGCCGAGTGGCTGGCCGTCCTGCTGTCGACCATCGCCTACGCCGTCATGACCGTCGCCGTCGCC
CTCATCACCCTGACCATCATCCTGCGCGCCCTCGACGCCGGCGTCGCGCCCCCCGGCAAGCTGTACGCCGTCGAC
GGCGGCAAGTACCGCGTCCACGTCTATTGCAGCGGCAACCGCTCCGAGCCGCGCCGCGACGGCGGCGACGACGAC
GACGCCCGGCAGCCGACGGTCCTGTTCGAGGCCGGCGAGCGGCCCGTCGAGGAGGACCTGTGGCCGCTGGCCGAC
AACGCCGTCCGCAACGGCTCCATCGCGCGCTACTGCTTCGTCGACCGGCCCGGCATGGCCTGGTCCGACGCGGCG
CCGTCGCCGCTCTCGGCCGGCTTCGCCGTCGACGCCCTGAGCGAGGCGCTGGCGCAGGCGGGCGAGCGCGGGCCC
TGGGTCCTGGCCAGCGCCGGCATCGGCTCCATCTACTCGCGCGTCTTCTCCGCCCGCCACGGCCACGAGGTGCGC
GGCCTGCTGCTCATCGACCCGCTGCACGAGGACCTGCTGGGCCGCGTCGCCGCCCCGGGCCGCGGCTTCCTGCTG
TGGCTGCGCGGCGTCATCTCGCCGCTCGGCCTGGACCGCCTGTCGGGCGCCATCTTCCGCGGCCGCACCAGCCGC
GACCGCATCTACGGCCGCGCCTGGCAGCAGGGCAGCAAGGCCATCTACGCCCGGCTGCAGGAGAGCCTGGTGGCC
GACTCGTTCACGCTCCGCGACGTCCAGGGCAGCCGGCGCATCCAGGACCGCCGCACGCCCCTCGTCGTCGTCAGC
TCCGGCCTCGAGGTCCGCGACAGCCCGACGTGGAAGGACAAGCAGCGCGACCTGACGAGGCTGACGGACAATCTG
CGCCACTGGGACGTGGTCGACGGCGCGCCGCACCTCGTATGGGACACGCTCGACGGCCGCGACCAGATCGAGACG
AGGCTGCGGCAGTTGGTCCACGCATGA
Transcript >Hirsu2|9848
ATGGATCGCCTCCTCTGCCAGAGACGGAGACGGAGGCGGAGGCGGAGGCGGTTGCGGCGGAGGCGGCGGCGGAGG
AGGCGGCGGCGGGAGGGGAGGCCGGGTCGGGGCAAGGAGGAGGAGGAGGAGCGGCTGACGGGCCGGGCCGAGACG
AGGCGCACCCTGGCCGAGTGGCTGGCCGTCCTGCTGTCGACCATCGCCTACGCCGTCATGACCGTCGCCGTCGCC
CTCATCACCCTGACCATCATCCTGCGCGCCCTCGACGCCGGCGTCGCGCCCCCCGGCAAGCTGTACGCCGTCGAC
GGCGGCAAGTACCGCGTCCACGTCTATTGCAGCGGCAACCGCTCCGAGCCGCGCCGCGACGGCGGCGACGACGAC
GACGCCCGGCAGCCGACGGTCCTGTTCGAGGCCGGCGAGCGGCCCGTCGAGGAGGACCTGTGGCCGCTGGCCGAC
AACGCCGTCCGCAACGGCTCCATCGCGCGCTACTGCTTCGTCGACCGGCCCGGCATGGCCTGGTCCGACGCGGCG
CCGTCGCCGCTCTCGGCCGGCTTCGCCGTCGACGCCCTGAGCGAGGCGCTGGCGCAGGCGGGCGAGCGCGGGCCC
TGGGTCCTGGCCAGCGCCGGCATCGGCTCCATCTACTCGCGCGTCTTCTCCGCCCGCCACGGCCACGAGGTGCGC
GGCCTGCTGCTCATCGACCCGCTGCACGAGGACCTGCTGGGCCGCGTCGCCGCCCCGGGCCGCGGCTTCCTGCTG
TGGCTGCGCGGCGTCATCTCGCCGCTCGGCCTGGACCGCCTGTCGGGCGCCATCTTCCGCGGCCGCACCAGCCGC
GACCGCATCTACGGCCGCGCCTGGCAGCAGGGCAGCAAGGCCATCTACGCCCGGCTGCAGGAGAGCCTGGTGGCC
GACTCGTTCACGCTCCGCGACGTCCAGGGCAGCCGGCGCATCCAGGACCGCCGCACGCCCCTCGTCGTCGTCAGC
TCCGGCCTCGAGGTCCGCGACAGCCCGACGTGGAAGGACAAGCAGCGCGACCTGACGAGGCTGACGGACAATCTG
CGCCACTGGGACGTGGTCGACGGCGCGCCGCACCTCGTATGGGACACGCTCGACGGCCGCGACCAGATCGAGACG
AGGCTGCGGCAGTTGGTCCACGCATGA
Gene >Hirsu2|9848
ATGGATCGCCTCCTCTGCCAGAGACGGAGACGGAGGCGGAGGCGGAGGCGGTTGCGGCGGAGGCGGCGGCGGAGG
AGGCGGCGGCGGGAGGGGAGGCCGGGTCGGGGCAAGGAGGAGGAGGAGGAGCGGCTGACGGGCCGGGCCGAGACG
AGGCGCACCCTGGCCGAGTGGCTGGCCGTCCTGCTGTCGACCATCGCCTACGCCGTCATGACCGTCGCCGTCGCC
CTCATCACCCTGACCATCATCCTGCGCGCCCTCGACGCCGGCGTCGCGCCCCCCGGCAAGCTGTACGCCGTCGAC
GGCGGCAAGTACCGCGTCCACGTCTATTGCAGCGGCAACCGCTCCGAGCCGCGCCGCGACGGCGGCGACGACGAC
GACGCCCGGCAGCCGACGGTCCTGTTCGAGGCCGGCGAGCGGCCCGTCGAGGAGGACCTGTGGCCGCTGGCCGAC
AACGCCGTCCGCAACGGCTCCATCGCGCGCTACTGCTTCGTCGACCGGCCCGGCATGGCCTGGTCCGACGCGGCG
CCGTCGCCGCTCTCGGCCGGCTTCGCCGTCGACGCCCTGAGCGAGGCGCTGGCGCAGGCGGGCGAGCGCGGGCCC
TGGGTCCTGGCCAGCGCCGGCATCGGCTCCATCTACTCGCGCGTCTTCTCCGCCCGCCACGGCCACGAGGTGCGC
GGCCTGCTGCTCATCGACCCGCTGCACGAGGACCTGCTGGGCCGCGTCGCCGCCCCGGGCCGCGGCTTCCTGCTG
TGGCTGCGCGGCGTCATCTCGCCGCTCGGCCTGGACCGCCTGTCGGGCGCCATCTTCCGCGGCCGCACCAGCCGC
GACCGCATCTACGGCCGCGCCTGGCAGCAGGGCAGCAAGGCCATCTACGCCCGGCTGCAGGAGAGCCTGGTGGCC
GACTCGTTCACGCTCCGCGACGTCCAGGGCAGCCGGCGCATCCAGGACCGCCGCACGCCCCTCGTCGTCGTCAGC
TCCGGCCTCGAGGTCCGCGACAGCCCGACGTGGAAGGACAAGCAGCGCGACCTGACGAGGCTGACGGACAATCTG
CGCCACTGGGACGTGGTCGACGGCGCGCCGCACCTCGTATGGGACACGCTCGACGGCCGCGACCAGATCGAGACG
AGGCTGCGGCAGTTGGTCCACGCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail