Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9847
Gene name
LocationContig_748:1249..5135
Strand-
Gene length (bp)3886
Transcript length (bp)3522
Coding sequence length (bp)3522
Protein length (aa) 1174

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 3.9E-35 841 994
PF00412 LIM LIM domain 2.0E-09 91 150
PF00412 LIM LIM domain 6.6E-12 155 211
PF00412 LIM LIM domain 5.7E-05 461 515

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 78 1084 0.0E+00
sp|P35688|LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRG1 PE=1 SV=3 84 1091 1.0E-158
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 90 244 1.0E-25
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 90 244 1.0E-25
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 90 244 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 78 1084 0.0E+00
sp|P35688|LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRG1 PE=1 SV=3 84 1091 1.0E-158
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 90 244 1.0E-25
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 90 244 1.0E-25
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 90 244 2.0E-25
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 90 244 2.0E-25
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 90 244 2.0E-25
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 91 245 1.0E-20
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 90 245 3.0E-19
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 90 245 4.0E-19
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 90 249 9.0E-19
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 90 245 2.0E-18
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 90 246 3.0E-18
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 91 245 4.0E-18
sp|Q63744|RHG07_RAT Rho GTPase-activating protein 7 OS=Rattus norvegicus GN=Dlc1 PE=1 SV=3 773 989 1.0E-17
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 91 244 2.0E-17
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 91 244 2.0E-17
sp|O43182|RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens GN=ARHGAP6 PE=1 SV=3 814 1026 2.0E-17
sp|O54834|RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus GN=Arhgap6 PE=1 SV=3 814 1026 2.0E-17
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 91 244 3.0E-17
sp|Q8K0Q5|RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus GN=Arhgap18 PE=1 SV=1 796 989 3.0E-17
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 91 244 3.0E-17
sp|B9VTT2|RHG07_CANLF Rho GTPase-activating protein 7 OS=Canis lupus familiaris GN=DLC1 PE=2 SV=1 773 989 3.0E-17
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 91 244 3.0E-17
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 91 244 4.0E-17
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 91 244 4.0E-17
sp|A7E300|RHG07_BOVIN Rho GTPase-activating protein 7 OS=Bos taurus GN=DLC1 PE=2 SV=1 773 989 4.0E-17
sp|Q96QB1|RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens GN=DLC1 PE=1 SV=4 773 989 4.0E-17
sp|Q9R0Z9|RHG07_MOUSE Rho GTPase-activating protein 7 OS=Mus musculus GN=Dlc1 PE=1 SV=2 773 989 7.0E-17
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 91 212 1.0E-16
sp|Q5TG30|RHG40_HUMAN Rho GTPase-activating protein 40 OS=Homo sapiens GN=ARHGAP40 PE=3 SV=3 776 991 4.0E-16
sp|Q923Q2|STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus GN=Stard13 PE=1 SV=5 773 1035 4.0E-16
sp|Q9Y3M8|STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens GN=STARD13 PE=1 SV=2 773 989 8.0E-16
sp|Q8N392|RHG18_HUMAN Rho GTPase-activating protein 18 OS=Homo sapiens GN=ARHGAP18 PE=1 SV=3 796 989 1.0E-15
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 91 241 2.0E-15
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 91 243 2.0E-15
sp|P11274|BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens GN=BCR PE=1 SV=2 797 1024 6.0E-15
sp|Q6PAJ1|BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus GN=Bcr PE=1 SV=3 794 1024 7.0E-15
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 91 241 1.0E-14
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 91 244 1.0E-14
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 91 244 1.0E-14
sp|Q5SSM3|RHG44_MOUSE Rho GTPase-activating protein 44 OS=Mus musculus GN=Arhgap44 PE=1 SV=1 787 1013 3.0E-14
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 32 192 3.0E-14
sp|F1LQX4|RHG44_RAT Rho GTPase-activating protein 44 OS=Rattus norvegicus GN=Arhgap44 PE=1 SV=2 787 1013 3.0E-14
sp|Q8K031|STAR8_MOUSE StAR-related lipid transfer protein 8 OS=Mus musculus GN=Stard8 PE=1 SV=2 776 989 4.0E-14
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 82 230 7.0E-14
sp|Q17R89|RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens GN=ARHGAP44 PE=1 SV=1 787 989 9.0E-14
sp|P55194|3BP1_MOUSE SH3 domain-binding protein 1 OS=Mus musculus GN=Sh3bp1 PE=1 SV=2 859 1019 1.0E-13
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 84 244 1.0E-13
sp|Q80Y19|RHGBA_MOUSE Rho GTPase-activating protein 11A OS=Mus musculus GN=Arhgap11a PE=1 SV=2 810 1047 2.0E-13
sp|Q68EM7|RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens GN=ARHGAP17 PE=1 SV=1 810 1013 2.0E-13
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 84 244 2.0E-13
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 804 1013 3.0E-13
sp|Q6P4F7|RHGBA_HUMAN Rho GTPase-activating protein 11A OS=Homo sapiens GN=ARHGAP11A PE=1 SV=2 813 1027 4.0E-13
sp|Q3UIA2|RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus GN=Arhgap17 PE=1 SV=1 810 1013 4.0E-13
sp|Q99N37|RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus GN=Arhgap17 PE=1 SV=1 810 1013 4.0E-13
sp|Q54FG5|GACJJ_DICDI Rho GTPase-activating protein gacJJ OS=Dictyostelium discoideum GN=gacJJ PE=3 SV=1 811 989 4.0E-13
sp|Q8N103|TAGAP_HUMAN T-cell activation Rho GTPase-activating protein OS=Homo sapiens GN=TAGAP PE=1 SV=1 784 1019 5.0E-13
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 91 212 6.0E-13
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 91 203 7.0E-13
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 90 243 7.0E-13
sp|Q8BN58|RHG28_MOUSE Rho GTPase-activating protein 28 OS=Mus musculus GN=Arhgap28 PE=1 SV=1 792 1075 7.0E-13
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 85 244 8.0E-13
sp|Q9P2N2|RHG28_HUMAN Rho GTPase-activating protein 28 OS=Homo sapiens GN=ARHGAP28 PE=1 SV=3 792 1050 9.0E-13
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 85 244 9.0E-13
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 91 255 1.0E-12
sp|Q03070|CHIO_RAT Beta-chimaerin OS=Rattus norvegicus GN=Chn2 PE=2 SV=1 841 1015 1.0E-12
sp|P52757|CHIO_HUMAN Beta-chimaerin OS=Homo sapiens GN=CHN2 PE=1 SV=2 828 1015 1.0E-12
sp|Q7TQJ8|WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus GN=Wtip PE=1 SV=1 73 243 1.0E-12
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 85 244 2.0E-12
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 90 209 2.0E-12
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 87 244 2.0E-12
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 28 244 2.0E-12
sp|Q80XD1|CHIO_MOUSE Beta-chimaerin OS=Mus musculus GN=Chn2 PE=1 SV=2 828 1015 3.0E-12
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 814 1000 3.0E-12
sp|A4II46|ABR_XENTR Active breakpoint cluster region-related protein OS=Xenopus tropicalis GN=abr PE=2 SV=1 804 989 3.0E-12
sp|Q92502|STAR8_HUMAN StAR-related lipid transfer protein 8 OS=Homo sapiens GN=STARD8 PE=1 SV=2 776 989 3.0E-12
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 91 211 4.0E-12
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 91 211 4.0E-12
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 43 244 4.0E-12
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 91 204 4.0E-12
sp|Q3KRB8|RHGBB_HUMAN Rho GTPase-activating protein 11B OS=Homo sapiens GN=ARHGAP11B PE=2 SV=1 813 989 4.0E-12
sp|Q6Y5D8|RHG10_MOUSE Rho GTPase-activating protein 10 OS=Mus musculus GN=Arhgap10 PE=1 SV=2 810 1131 4.0E-12
sp|Q8AVG0|ABR_XENLA Active breakpoint cluster region-related protein OS=Xenopus laevis GN=abr PE=2 SV=1 804 989 4.0E-12
sp|Q5SSL4|ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus GN=Abr PE=1 SV=1 804 989 5.0E-12
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 84 244 5.0E-12
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 91 213 6.0E-12
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 814 1000 6.0E-12
sp|Q9Y3L3|3BP1_HUMAN SH3 domain-binding protein 1 OS=Homo sapiens GN=SH3BP1 PE=1 SV=3 859 1027 6.0E-12
sp|P15882|CHIN_HUMAN N-chimaerin OS=Homo sapiens GN=CHN1 PE=1 SV=3 828 1015 6.0E-12
sp|A6QNS3|ABR_BOVIN Active breakpoint cluster region-related protein OS=Bos taurus GN=ABR PE=2 SV=1 804 989 6.0E-12
sp|Q12979|ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens GN=ABR PE=2 SV=2 804 989 7.0E-12
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 91 241 8.0E-12
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 78 192 9.0E-12
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 90 207 9.0E-12
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 91 203 1.0E-11
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 91 203 1.0E-11
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 91 318 1.0E-11
sp|A2AB59|RHG27_MOUSE Rho GTPase-activating protein 27 OS=Mus musculus GN=Arhgap27 PE=1 SV=1 804 1013 1.0E-11
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 840 1000 1.0E-11
sp|O94988|FA13A_HUMAN Protein FAM13A OS=Homo sapiens GN=FAM13A PE=1 SV=2 803 992 1.0E-11
sp|P34288|PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans GN=pac-1 PE=1 SV=4 840 1027 1.0E-11
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 90 208 2.0E-11
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 91 211 2.0E-11
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 78 192 2.0E-11
sp|A1A4S6|RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo sapiens GN=ARHGAP10 PE=1 SV=1 842 1039 2.0E-11
sp|Q17QN0|CHIN_BOVIN N-chimaerin OS=Bos taurus GN=CHN1 PE=2 SV=1 828 1015 2.0E-11
sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 804 1013 2.0E-11
sp|Q559A0|GACU_DICDI Rho GTPase-activating protein gacU OS=Dictyostelium discoideum GN=gacU PE=3 SV=1 805 989 2.0E-11
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 91 212 3.0E-11
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 91 212 3.0E-11
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 91 242 3.0E-11
sp|O74360|RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga4 PE=1 SV=2 838 1009 3.0E-11
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 91 244 3.0E-11
sp|Q9U3F4|ZYX_CAEEL Zyxin OS=Caenorhabditis elegans GN=zyx-1 PE=1 SV=1 90 243 3.0E-11
sp|Q54TH9|GACY_DICDI Rho GTPase-activating protein gacY OS=Dictyostelium discoideum GN=gacY PE=3 SV=1 758 1016 3.0E-11
sp|Q08DP6|RHG10_BOVIN Rho GTPase-activating protein 10 OS=Bos taurus GN=ARHGAP10 PE=2 SV=1 810 1023 3.0E-11
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 91 211 3.0E-11
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 84 244 4.0E-11
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 91 244 4.0E-11
sp|A6NIX2|WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens GN=WTIP PE=1 SV=3 73 243 4.0E-11
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 69 222 4.0E-11
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 91 242 5.0E-11
sp|Q62172|RBP1_MOUSE RalA-binding protein 1 OS=Mus musculus GN=Ralbp1 PE=1 SV=4 811 988 5.0E-11
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 69 243 5.0E-11
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 90 243 6.0E-11
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 69 243 6.0E-11
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 91 211 7.0E-11
sp|B5DFQ4|RHG26_XENTR Rho GTPase-activating protein 26 OS=Xenopus tropicalis GN=arhgap26 PE=2 SV=1 825 1026 7.0E-11
sp|Q6REY9|RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus GN=Arhgap20 PE=1 SV=2 813 1030 7.0E-11
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 90 243 8.0E-11
sp|Q8N264|RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens GN=ARHGAP24 PE=1 SV=2 812 1096 8.0E-11
sp|Q54FF4|GACL_DICDI Rho GTPase-activating protein gacL OS=Dictyostelium discoideum GN=gacL PE=2 SV=1 813 989 8.0E-11
sp|Q5U4T3|RHG26_XENLA Rho GTPase-activating protein 26 OS=Xenopus laevis GN=arhgap26 PE=2 SV=1 825 1026 8.0E-11
sp|O35115|FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus GN=Fhl2 PE=1 SV=1 64 247 9.0E-11
sp|Q6DFG0|RH21A_XENLA Rho GTPase-activating protein 21-A OS=Xenopus laevis GN=arhgap21-a PE=2 SV=1 840 989 9.0E-11
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 91 203 1.0E-10
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 91 211 1.0E-10
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 91 204 1.0E-10
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 24 243 1.0E-10
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 84 244 1.0E-10
sp|Q54YV1|GACII_DICDI Rho GTPase-activating protein gacII OS=Dictyostelium discoideum GN=gacII PE=3 SV=1 859 1048 1.0E-10
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 91 206 1.0E-10
sp|A9LS46|WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis GN=wtip PE=2 SV=1 90 243 1.0E-10
sp|Q5FWK3|RHG01_MOUSE Rho GTPase-activating protein 1 OS=Mus musculus GN=Arhgap1 PE=1 SV=1 814 998 1.0E-10
sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 830 1022 1.0E-10
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 91 203 2.0E-10
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 91 241 2.0E-10
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 154 243 2.0E-10
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 76 243 2.0E-10
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 90 203 2.0E-10
sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 830 1013 2.0E-10
sp|O42565|LIMK1_XENLA LIM domain kinase 1 OS=Xenopus laevis GN=limk1 PE=2 SV=1 154 244 2.0E-10
sp|Q9WVM1|RGAP1_MOUSE Rac GTPase-activating protein 1 OS=Mus musculus GN=Racgap1 PE=1 SV=1 831 993 2.0E-10
sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 830 1013 2.0E-10
sp|A8DZE6|WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio GN=wtip PE=3 SV=1 90 243 2.0E-10
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 91 243 2.0E-10
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 91 241 3.0E-10
sp|Q07960|RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens GN=ARHGAP1 PE=1 SV=1 814 998 3.0E-10
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 91 243 3.0E-10
sp|Q6IFT4|RHG20_MOUSE Rho GTPase-activating protein 20 OS=Mus musculus GN=Arhgap20 PE=1 SV=1 813 1032 3.0E-10
sp|Q71FD7|FBLI1_MOUSE Filamin-binding LIM protein 1 OS=Mus musculus GN=Fblim1 PE=1 SV=2 88 258 3.0E-10
sp|O70433|FHL2_MOUSE Four and a half LIM domains protein 2 OS=Mus musculus GN=Fhl2 PE=1 SV=1 64 247 3.0E-10
sp|Q8BRH3|RHG19_MOUSE Rho GTPase-activating protein 19 OS=Mus musculus GN=Arhgap19 PE=1 SV=2 800 1023 3.0E-10
sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens GN=RALBP1 PE=1 SV=3 811 988 3.0E-10
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 91 223 4.0E-10
sp|Q9P2F6|RHG20_HUMAN Rho GTPase-activating protein 20 OS=Homo sapiens GN=ARHGAP20 PE=1 SV=2 792 1020 4.0E-10
sp|Q8WUP2|FBLI1_HUMAN Filamin-binding LIM protein 1 OS=Homo sapiens GN=FBLIM1 PE=1 SV=2 86 258 5.0E-10
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 46 244 5.0E-10
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 91 202 6.0E-10
sp|Q71M21|RH21B_XENLA Rho GTPase-activating protein 21-B OS=Xenopus laevis GN=arhgap21-b PE=2 SV=1 840 997 7.0E-10
sp|Q9VY77|AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster GN=jub PE=1 SV=3 90 264 7.0E-10
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 154 244 8.0E-10
sp|Q5F464|LPP_CHICK Lipoma-preferred partner homolog OS=Gallus gallus GN=LPP PE=2 SV=1 91 243 8.0E-10
sp|Q811P8|RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus GN=Arhgap32 PE=1 SV=2 788 989 8.0E-10
sp|Q1JQB5|FBLI1_BOVIN Filamin-binding LIM protein 1 OS=Bos taurus GN=FBLIM1 PE=2 SV=1 86 258 9.0E-10
sp|P97447|FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus GN=Fhl1 PE=1 SV=3 91 247 9.0E-10
sp|Q9UBR4|LHX3_HUMAN LIM/homeobox protein Lhx3 OS=Homo sapiens GN=LHX3 PE=1 SV=2 72 209 9.0E-10
sp|Q5XI07|LPP_RAT Lipoma-preferred partner homolog OS=Rattus norvegicus GN=Lpp PE=1 SV=1 35 243 9.0E-10
sp|Q9WUH4|FHL1_RAT Four and a half LIM domains protein 1 OS=Rattus norvegicus GN=Fhl1 PE=2 SV=1 91 247 9.0E-10
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 91 241 1.0E-09
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 91 241 1.0E-09
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 91 202 1.0E-09
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 89 214 1.0E-09
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 90 203 1.0E-09
sp|Q9VTU3|RG68F_DROME Rho GTPase-activating protein 68F OS=Drosophila melanogaster GN=RhoGAP68F PE=1 SV=1 814 1002 1.0E-09
sp|Q9H0H5|RGAP1_HUMAN Rac GTPase-activating protein 1 OS=Homo sapiens GN=RACGAP1 PE=1 SV=1 831 998 1.0E-09
sp|Q91V57|CHIN_MOUSE N-chimaerin OS=Mus musculus GN=Chn1 PE=1 SV=2 828 992 1.0E-09
sp|Q9UNA1|RHG26_HUMAN Rho GTPase-activating protein 26 OS=Homo sapiens GN=ARHGAP26 PE=1 SV=1 823 1028 1.0E-09
sp|A7KAX9|RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens GN=ARHGAP32 PE=1 SV=1 788 989 1.0E-09
sp|Q5REN1|FBLI1_PONAB Filamin-binding LIM protein 1 OS=Pongo abelii GN=FBLIM1 PE=2 SV=1 86 258 1.0E-09
sp|Q90421|LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio GN=lhx3 PE=2 SV=1 90 240 1.0E-09
sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 799 1014 1.0E-09
sp|Q5U2Z2|AJUBA_RAT LIM domain-containing protein ajuba OS=Rattus norvegicus GN=Ajuba PE=1 SV=1 63 243 1.0E-09
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 80 214 2.0E-09
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 80 214 2.0E-09
sp|Q91XC0|AJUBA_MOUSE LIM domain-containing protein ajuba OS=Mus musculus GN=Ajuba PE=1 SV=1 63 243 2.0E-09
sp|P53412|LHX3_CHICK LIM/homeobox protein Lhx3 OS=Gallus gallus GN=LHX3 PE=2 SV=1 85 240 2.0E-09
sp|Q04584|ZYX_CHICK Zyxin OS=Gallus gallus GN=ZYX PE=1 SV=1 85 225 2.0E-09
sp|Q6ZQ82|RHG26_MOUSE Rho GTPase-activating protein 26 OS=Mus musculus GN=Arhgap26 PE=1 SV=3 823 1028 2.0E-09
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 91 242 3.0E-09
sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 812 989 3.0E-09
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 828 992 3.0E-09
sp|Q62796|RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus GN=Ralbp1 PE=1 SV=3 811 988 3.0E-09
sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 811 989 3.0E-09
sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=1 SV=2 812 1014 3.0E-09
sp|Q54SL6|GACQ_DICDI Rho GTPase-activating protein gacQ OS=Dictyostelium discoideum GN=gacQ PE=3 SV=1 811 986 3.0E-09
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 91 242 4.0E-09
sp|E9Q6X9|RHG40_MOUSE Rho GTPase-activating protein 40 OS=Mus musculus GN=Arhgap40 PE=3 SV=1 812 989 4.0E-09
sp|Q8R5G7|ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Arap3 PE=1 SV=3 840 1067 4.0E-09
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 90 206 5.0E-09
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 154 244 5.0E-09
sp|Q9PT60|RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis GN=ralbp1-a PE=1 SV=3 811 988 5.0E-09
sp|Q13642|FHL1_HUMAN Four and a half LIM domains protein 1 OS=Homo sapiens GN=FHL1 PE=1 SV=4 91 222 5.0E-09
sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens GN=LPP PE=1 SV=1 91 243 6.0E-09
sp|A2RUV4|RHG21_XENTR Rho GTPase-activating protein 21 OS=Xenopus tropicalis GN=arhgap21 PE=2 SV=1 840 997 6.0E-09
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 154 244 7.0E-09
sp|Q8C0D4|RHG12_MOUSE Rho GTPase-activating protein 12 OS=Mus musculus GN=Arhgap12 PE=1 SV=2 806 1013 7.0E-09
sp|E1BKA3|AJUBA_BOVIN LIM domain-containing protein ajuba OS=Bos taurus GN=AJUBA PE=3 SV=1 63 243 7.0E-09
sp|P53670|LIMK2_RAT LIM domain kinase 2 OS=Rattus norvegicus GN=Limk2 PE=2 SV=1 91 217 7.0E-09
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 91 255 8.0E-09
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 90 207 8.0E-09
sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 806 1019 8.0E-09
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 90 207 9.0E-09
sp|P38339|RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD1 PE=1 SV=1 809 1013 9.0E-09
sp|Q5VT97|SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens GN=SYDE2 PE=1 SV=2 813 1012 9.0E-09
sp|Q5F3G0|RHG19_CHICK Rho GTPase-activating protein 19 OS=Gallus gallus GN=ARHGAP19 PE=2 SV=1 800 1023 9.0E-09
sp|Q5ZMW5|RHG26_CHICK Rho GTPase-activating protein 26 OS=Gallus gallus GN=ARHGAP26 PE=1 SV=2 825 1024 9.0E-09
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 91 241 1.0E-08
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 90 209 1.0E-08
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 90 211 1.0E-08
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 90 207 1.0E-08
sp|Q9P227|RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 839 997 1.0E-08
sp|Q8IR79|LIMK1_DROME LIM domain kinase 1 OS=Drosophila melanogaster GN=LIMK1 PE=1 SV=1 84 213 1.0E-08
sp|Q80YF9|RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus GN=Arhgap33 PE=1 SV=1 858 1019 1.0E-08
sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=1 SV=2 812 1014 1.0E-08
sp|P46941|TG325_CAEEL WW domain-containing protein tag-325 OS=Caenorhabditis elegans GN=tag-325 PE=3 SV=1 763 998 1.0E-08
sp|O54785|LIMK2_MOUSE LIM domain kinase 2 OS=Mus musculus GN=Limk2 PE=1 SV=2 91 217 1.0E-08
sp|Q96IF1|AJUBA_HUMAN LIM domain-containing protein ajuba OS=Homo sapiens GN=AJUBA PE=1 SV=1 63 243 1.0E-08
sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 799 1014 1.0E-08
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 91 198 2.0E-08
sp|O42565|LIMK1_XENLA LIM domain kinase 1 OS=Xenopus laevis GN=limk1 PE=2 SV=1 90 209 2.0E-08
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 90 207 2.0E-08
sp|Q9V9S7|SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster GN=RhoGAP100F PE=1 SV=2 813 989 2.0E-08
sp|Q6AYC5|RHG15_RAT Rho GTPase-activating protein 15 OS=Rattus norvegicus GN=Arhgap15 PE=1 SV=1 799 1019 2.0E-08
sp|Q69ZH9|RHG23_MOUSE Rho GTPase-activating protein 23 OS=Mus musculus GN=Arhgap23 PE=1 SV=2 839 997 2.0E-08
sp|Q8WWN8|ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ARAP3 PE=1 SV=1 840 1067 2.0E-08
sp|Q14192|FHL2_HUMAN Four and a half LIM domains protein 2 OS=Homo sapiens GN=FHL2 PE=1 SV=3 85 247 2.0E-08
sp|Q2M1Z3|RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens GN=ARHGAP31 PE=1 SV=2 800 989 2.0E-08
sp|Q28FG2|PRIC1_XENTR Prickle-like protein 1 OS=Xenopus tropicalis GN=prickle1 PE=2 SV=1 90 239 2.0E-08
sp|Q6ZW31|SYDE1_HUMAN Rho GTPase-activating protein SYDE1 OS=Homo sapiens GN=SYDE1 PE=1 SV=1 789 989 2.0E-08
sp|Q4LDD4|ARAP1_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Arap1 PE=1 SV=2 735 989 2.0E-08
sp|O97581|LHX3_PIG LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa GN=LHX3 PE=2 SV=1 90 209 2.0E-08
sp|Q14CB8|RHG19_HUMAN Rho GTPase-activating protein 19 OS=Homo sapiens GN=ARHGAP19 PE=1 SV=1 800 1023 2.0E-08
sp|A4IF90|RHG15_BOVIN Rho GTPase-activating protein 15 OS=Bos taurus GN=ARHGAP15 PE=2 SV=1 799 958 2.0E-08
sp|A6X8Z5|RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus GN=Arhgap31 PE=1 SV=1 800 1013 2.0E-08
sp|P50481|LHX3_MOUSE LIM/homeobox protein Lhx3 OS=Mus musculus GN=Lhx3 PE=1 SV=1 90 209 3.0E-08
sp|P85298|RHG08_HUMAN Rho GTPase-activating protein 8 OS=Homo sapiens GN=ARHGAP8 PE=1 SV=1 814 1024 3.0E-08
sp|Q8IWW6|RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens GN=ARHGAP12 PE=1 SV=1 806 1019 3.0E-08
sp|O74398|YOCC_SCHPO LIM domain-containing protein C4F6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.12 PE=1 SV=1 89 243 3.0E-08
sp|Q5T5U3|RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 840 989 3.0E-08
sp|Q96P48|ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ARAP1 PE=1 SV=3 840 989 3.0E-08
sp|Q7Z6I6|RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens GN=ARHGAP30 PE=1 SV=3 798 1019 3.0E-08
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 152 243 4.0E-08
sp|O14559|RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens GN=ARHGAP33 PE=1 SV=2 858 1019 4.0E-08
sp|Q6GPD0|RHG32_XENLA Rho GTPase-activating protein 32 OS=Xenopus laevis GN=arhgap32 PE=2 SV=1 788 989 4.0E-08
sp|Q90WV2|PRI1B_XENLA Prickle-like protein 1-B OS=Xenopus laevis GN=prickle1-b PE=2 SV=2 90 239 4.0E-08
sp|Q90Z06|PRI1A_XENLA Prickle-like protein 1-A OS=Xenopus laevis GN=prickle1-a PE=1 SV=1 90 239 4.0E-08
sp|P36200|LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis GN=lhx3 PE=1 SV=1 81 240 4.0E-08
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 80 265 5.0E-08
sp|Q6DFV3|RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus GN=Arhgap21 PE=1 SV=1 840 989 5.0E-08
sp|A0JNI8|LHX9_BOVIN LIM/homeobox protein Lhx9 OS=Bos taurus GN=LHX9 PE=2 SV=2 71 209 5.0E-08
sp|Q8BFW7|LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus GN=Lpp PE=1 SV=1 91 243 5.0E-08
sp|Q80W90|LHX9_RAT LIM/homeobox protein Lhx9 OS=Rattus norvegicus GN=Lhx9 PE=2 SV=1 90 209 5.0E-08
sp|Q9NQ69|LHX9_HUMAN LIM/homeobox protein Lhx9 OS=Homo sapiens GN=LHX9 PE=1 SV=3 80 209 6.0E-08
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 91 198 7.0E-08
sp|P53671|LIMK2_HUMAN LIM domain kinase 2 OS=Homo sapiens GN=LIMK2 PE=1 SV=1 91 217 7.0E-08
sp|Q811M1|RHG15_MOUSE Rho GTPase-activating protein 15 OS=Mus musculus GN=Arhgap15 PE=1 SV=1 799 1019 7.0E-08
sp|Q54XT6|GACR_DICDI Rho GTPase-activating protein gacR OS=Dictyostelium discoideum GN=gacR PE=3 SV=1 813 989 7.0E-08
sp|Q86IG9|GACH_DICDI Rho GTPase-activating protein gacH OS=Dictyostelium discoideum GN=gacH PE=3 SV=1 856 1014 7.0E-08
sp|Q9WUH2|LHX9_MOUSE LIM/homeobox protein Lhx9 OS=Mus musculus GN=Lhx9 PE=1 SV=3 90 209 7.0E-08
sp|P53666|LIMK2_CHICK LIM domain kinase 2 OS=Gallus gallus GN=LIMK2 PE=2 SV=1 91 217 7.0E-08
sp|Q1LWV4|LHX9_DANRE LIM/homeobox protein Lhx9 OS=Danio rerio GN=lhx9 PE=2 SV=1 90 209 8.0E-08
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 91 198 9.0E-08
sp|A7MB27|RHG36_BOVIN Rho GTPase-activating protein 36 OS=Bos taurus GN=ARHGAP36 PE=2 SV=1 826 1023 9.0E-08
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 91 198 1.0E-07
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 91 195 1.0E-07
sp|Q9VIS1|CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster GN=CdGAPr PE=1 SV=2 858 992 1.0E-07
sp|Q969G2|LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens GN=LHX4 PE=1 SV=2 91 209 1.0E-07
sp|P53776|LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus GN=Lhx4 PE=1 SV=4 91 209 1.0E-07
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 91 206 2.0E-07
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 91 206 2.0E-07
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 91 195 2.0E-07
sp|Q13642|FHL1_HUMAN Four and a half LIM domains protein 1 OS=Homo sapiens GN=FHL1 PE=1 SV=4 91 244 2.0E-07
sp|B2RWW0|TAGAP_MOUSE T-cell activation Rho GTPase-activating protein OS=Mus musculus GN=Tagap PE=2 SV=2 781 1019 2.0E-07
sp|Q54WY8|GACN_DICDI Rho GTPase-activating protein gacN OS=Dictyostelium discoideum GN=gacN PE=3 SV=1 856 1027 2.0E-07
sp|Q9CXP4|RHG08_MOUSE Rho GTPase-activating protein 8 OS=Mus musculus GN=Arhgap8 PE=2 SV=3 814 1021 2.0E-07
sp|Q19157|PIN2_CAEEL LIM domain-containing protein pin-2 OS=Caenorhabditis elegans GN=pin-2 PE=2 SV=2 74 247 2.0E-07
sp|B2RQE8|RHG42_MOUSE Rho GTPase-activating protein 42 OS=Mus musculus GN=Arhgap42 PE=1 SV=1 900 1047 2.0E-07
sp|Q9Z1Y4|TRIP6_MOUSE Thyroid receptor-interacting protein 6 OS=Mus musculus GN=Trip6 PE=1 SV=1 91 225 2.0E-07
sp|P50458|LHX2_HUMAN LIM/homeobox protein Lhx2 OS=Homo sapiens GN=LHX2 PE=2 SV=2 84 207 2.0E-07
sp|Q9Z0S2|LHX2_MOUSE LIM/homeobox protein Lhx2 OS=Mus musculus GN=Lhx2 PE=1 SV=1 84 207 2.0E-07
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 82 225 2.0E-07
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 91 206 3.0E-07
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 84 218 3.0E-07
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 90 207 3.0E-07
sp|A6NI28|RHG42_HUMAN Rho GTPase-activating protein 42 OS=Homo sapiens GN=ARHGAP42 PE=1 SV=3 843 1047 3.0E-07
sp|Q54QF4|MGP4_DICDI Mental retardation GTPase activating protein homolog 4 OS=Dictyostelium discoideum GN=mgp4 PE=3 SV=1 813 989 3.0E-07
sp|Q20498|RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans GN=rrc-1 PE=1 SV=3 809 992 3.0E-07
sp|Q3SX26|TRIP6_BOVIN Thyroid receptor-interacting protein 6 OS=Bos taurus GN=TRIP6 PE=2 SV=1 91 225 3.0E-07
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 90 203 4.0E-07
sp|Q13017|RHG05_HUMAN Rho GTPase-activating protein 5 OS=Homo sapiens GN=ARHGAP5 PE=1 SV=2 814 988 4.0E-07
sp|P36198|LHX2_RAT LIM/homeobox protein Lhx2 OS=Rattus norvegicus GN=Lhx2 PE=2 SV=1 84 207 4.0E-07
sp|Q3B8H4|RBTN1_XENLA Rhombotin-1 OS=Xenopus laevis GN=lmo1 PE=2 SV=1 72 207 4.0E-07
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 843 1028 5.0E-07
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 90 225 5.0E-07
sp|A2I8Z7|LHX9_ASTFA LIM/homeobox protein Lhx9 OS=Astyanax fasciatus GN=lhx9 PE=2 SV=1 69 209 5.0E-07
sp|Q9U1I1|ESN_DROME Protein espinas OS=Drosophila melanogaster GN=esn PE=2 SV=1 89 239 5.0E-07
sp|Q9H2C1|LHX5_HUMAN LIM/homeobox protein Lhx5 OS=Homo sapiens GN=LHX5 PE=2 SV=1 91 202 5.0E-07
sp|Q924W9|RBTN1_MOUSE Rhombotin-1 OS=Mus musculus GN=Lmo1 PE=2 SV=1 86 207 6.0E-07
sp|Q6ZRI8|RHG36_HUMAN Rho GTPase-activating protein 36 OS=Homo sapiens GN=ARHGAP36 PE=2 SV=1 826 1023 6.0E-07
sp|Q6ZM89|RH42A_DANRE Rho GTPase-activating protein 42 OS=Danio rerio GN=arhgap42a PE=2 SV=3 900 1024 6.0E-07
sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens GN=LIMD1 PE=1 SV=1 91 214 6.0E-07
sp|Q8JFQ2|RBTN1_DANRE Rhombotin-1 OS=Danio rerio GN=lmo1 PE=2 SV=1 86 207 6.0E-07
sp|P25800|RBTN1_HUMAN Rhombotin-1 OS=Homo sapiens GN=LMO1 PE=1 SV=1 86 207 6.0E-07
sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens GN=TRIP6 PE=1 SV=3 91 225 6.0E-07
sp|P20154|LIN11_CAEEL Protein lin-11 OS=Caenorhabditis elegans GN=lin-11 PE=1 SV=2 91 209 7.0E-07
sp|Q0P5B3|RBTN1_BOVIN Rhombotin-1 OS=Bos taurus GN=LMO1 PE=2 SV=1 86 207 7.0E-07
sp|P37137|LHX5_XENLA LIM/homeobox protein Lhx5 OS=Xenopus laevis GN=lhx5 PE=1 SV=2 91 202 7.0E-07
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 91 210 8.0E-07
sp|Q640N3|RHG30_MOUSE Rho GTPase-activating protein 30 OS=Mus musculus GN=Arhgap30 PE=1 SV=3 858 1019 8.0E-07
sp|Q90881|LHX9_CHICK LIM/homeobox protein Lhx9 OS=Gallus gallus GN=LHX9 PE=2 SV=2 90 209 8.0E-07
sp|Q99MB5|LMO3_RAT LIM domain only protein 3 OS=Rattus norvegicus GN=Lmo3 PE=2 SV=2 86 207 8.0E-07
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 91 243 9.0E-07
sp|Q19157|PIN2_CAEEL LIM domain-containing protein pin-2 OS=Caenorhabditis elegans GN=pin-2 PE=2 SV=2 90 241 1.0E-06
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 91 210 1.0E-06
sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens GN=LIMD1 PE=1 SV=1 91 243 1.0E-06
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 91 225 1.0E-06
sp|Q99J31|OPHN1_MOUSE Oligophrenin-1 OS=Mus musculus GN=Ophn1 PE=1 SV=1 843 1025 1.0E-06
sp|Q9DBZ9|SYDE1_MOUSE Rho GTPase-activating protein SYDE1 OS=Mus musculus GN=Syde1 PE=1 SV=1 801 989 1.0E-06
sp|P83509|RHG35_CANLF Rho GTPase-activating protein 35 OS=Canis lupus familiaris GN=ARHGAP35 PE=2 SV=1 805 990 1.0E-06
sp|P61376|LHX5_RAT LIM/homeobox protein Lhx5 OS=Rattus norvegicus GN=Lhx5 PE=2 SV=1 91 202 1.0E-06
sp|P61375|LHX5_MOUSE LIM/homeobox protein Lhx5 OS=Mus musculus GN=Lhx5 PE=2 SV=1 91 202 1.0E-06
sp|P0CAX5|OPHN1_RAT Oligophrenin-1 OS=Rattus norvegicus GN=Ophn1 PE=1 SV=1 843 1025 1.0E-06
sp|Q5TD97|FHL5_HUMAN Four and a half LIM domains protein 5 OS=Homo sapiens GN=FHL5 PE=1 SV=1 91 244 1.0E-06
sp|Q6PCS4|RHG29_DANRE Rho GTPase-activating protein 29 OS=Danio rerio GN=arhgap29 PE=2 SV=1 813 1023 1.0E-06
sp|Q7Z3G6|PRIC2_HUMAN Prickle-like protein 2 OS=Homo sapiens GN=PRICKLE2 PE=1 SV=2 90 239 1.0E-06
sp|Q6INE5|RHG19_XENLA Rho GTPase-activating protein 19 OS=Xenopus laevis GN=arhgap19 PE=2 SV=1 790 1023 1.0E-06
sp|Q9NRY4|RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens GN=ARHGAP35 PE=1 SV=3 805 990 1.0E-06
sp|Q96MT3|PRIC1_HUMAN Prickle-like protein 1 OS=Homo sapiens GN=PRICKLE1 PE=1 SV=2 90 239 1.0E-06
sp|Q9Z1Y4|TRIP6_MOUSE Thyroid receptor-interacting protein 6 OS=Mus musculus GN=Trip6 PE=1 SV=1 91 203 2.0E-06
sp|Q6AXT1|FHL5_RAT Four and a half LIM domains protein 5 OS=Rattus norvegicus GN=Fhl5 PE=2 SV=1 91 244 2.0E-06
sp|Q7QJT4|PRIC1_ANOGA Protein prickle OS=Anopheles gambiae GN=pk PE=3 SV=4 88 239 2.0E-06
sp|Q0VA45|ZYX_XENTR Zyxin OS=Xenopus tropicalis GN=zyx PE=2 SV=1 90 225 2.0E-06
sp|Q5RBW7|LMO3_PONAB LIM domain only protein 3 OS=Pongo abelii GN=LMO3 PE=2 SV=1 91 207 2.0E-06
sp|Q8BZL8|LMO3_MOUSE LIM domain only protein 3 OS=Mus musculus GN=Lmo3 PE=2 SV=1 91 207 2.0E-06
sp|Q8TAP4|LMO3_HUMAN LIM domain only protein 3 OS=Homo sapiens GN=LMO3 PE=1 SV=1 91 207 2.0E-06
sp|Q2KIA3|LMO3_BOVIN LIM domain only protein 3 OS=Bos taurus GN=LMO3 PE=2 SV=1 91 207 2.0E-06
sp|Q3U5C7|PRIC1_MOUSE Prickle-like protein 1 OS=Mus musculus GN=Prickle1 PE=1 SV=1 90 239 2.0E-06
sp|Q2YDK0|FHL5_BOVIN Four and a half LIM domains protein 5 OS=Bos taurus GN=FHL5 PE=2 SV=1 91 244 2.0E-06
sp|P81128|RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus GN=Arhgap35 PE=1 SV=2 805 988 2.0E-06
sp|Q06BR1|LIMD1_XENLA LIM domain-containing protein 1 OS=Xenopus laevis GN=limd1 PE=1 SV=1 91 204 2.0E-06
sp|Q91YM2|RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus GN=Arhgap35 PE=1 SV=3 805 988 2.0E-06
sp|P29674|LHX1_XENLA LIM/homeobox protein Lhx1 OS=Xenopus laevis GN=lhx1 PE=1 SV=1 91 202 2.0E-06
sp|Q52LW3|RHG29_HUMAN Rho GTPase-activating protein 29 OS=Homo sapiens GN=ARHGAP29 PE=1 SV=2 840 1014 2.0E-06
sp|O35115|FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus GN=Fhl2 PE=1 SV=1 91 244 3.0E-06
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 91 244 3.0E-06
sp|O70433|FHL2_MOUSE Four and a half LIM domains protein 2 OS=Mus musculus GN=Fhl2 PE=1 SV=1 91 244 4.0E-06
sp|Q7YQL5|OPHN1_PONPY Oligophrenin-1 OS=Pongo pygmaeus GN=OPHN1 PE=2 SV=1 843 1025 4.0E-06
sp|Q7YQL6|OPHN1_PANTR Oligophrenin-1 OS=Pan troglodytes GN=OPHN1 PE=2 SV=1 843 1025 4.0E-06
sp|O60890|OPHN1_HUMAN Oligophrenin-1 OS=Homo sapiens GN=OPHN1 PE=1 SV=1 843 1025 4.0E-06
sp|B5DEH0|LIMD1_RAT LIM domain-containing protein 1 OS=Rattus norvegicus GN=Limd1 PE=1 SV=1 91 243 4.0E-06
sp|B5DEH0|LIMD1_RAT LIM domain-containing protein 1 OS=Rattus norvegicus GN=Limd1 PE=1 SV=1 91 211 4.0E-06
sp|Q4R7A4|FHL5_MACFA Four and a half LIM domains protein 5 OS=Macaca fascicularis GN=FHL5 PE=2 SV=1 91 244 4.0E-06
sp|B7ZUL2|LIMD1_XENTR LIM domain-containing protein 1 OS=Xenopus tropicalis GN=limd1 PE=2 SV=1 91 204 4.0E-06
sp|Q9WTX7|FHL5_MOUSE Four and a half LIM domains protein 5 OS=Mus musculus GN=Fhl5 PE=1 SV=1 91 244 5.0E-06
sp|Q503U0|LMO3_DANRE LIM domain only protein 3 OS=Danio rerio GN=lmo3 PE=2 SV=1 91 207 5.0E-06
sp|A1Z6W3|PRIC1_DROME Protein prickle OS=Drosophila melanogaster GN=pk PE=1 SV=1 107 243 5.0E-06
sp|Q174I2|PRIC1_AEDAE Protein prickle OS=Aedes aegypti GN=pk PE=3 SV=1 75 239 5.0E-06
sp|B1AUC7|RHG36_MOUSE Rho GTPase-activating protein 36 OS=Mus musculus GN=Arhgap36 PE=2 SV=1 826 1023 6.0E-06
sp|Q9QXD8|LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus GN=Limd1 PE=1 SV=2 91 243 6.0E-06
sp|Q9QXD8|LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus GN=Limd1 PE=1 SV=2 91 211 6.0E-06
sp|Q2KI95|FHL2_BOVIN Four and a half LIM domains protein 2 OS=Bos taurus GN=FHL2 PE=2 SV=1 109 247 6.0E-06
sp|Q292U5|ESN_DROPS Protein espinas OS=Drosophila pseudoobscura pseudoobscura GN=esn PE=3 SV=1 89 239 6.0E-06
sp|Q5TD97|FHL5_HUMAN Four and a half LIM domains protein 5 OS=Homo sapiens GN=FHL5 PE=1 SV=1 91 243 7.0E-06
sp|Q32L23|LIMK2_BOVIN LIM domain kinase 2 OS=Bos taurus GN=LIMK2 PE=2 SV=1 91 217 7.0E-06
sp|Q90476|LHX1_DANRE LIM/homeobox protein Lhx1 OS=Danio rerio GN=lhx1a PE=2 SV=1 91 202 7.0E-06
sp|Q9YH16|LMO3_XENLA LIM domain only protein 3 OS=Xenopus laevis GN=lmo3 PE=2 SV=1 91 207 7.0E-06
sp|O35115|FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus GN=Fhl2 PE=1 SV=1 91 185 8.0E-06
sp|Q3SX26|TRIP6_BOVIN Thyroid receptor-interacting protein 6 OS=Bos taurus GN=TRIP6 PE=2 SV=1 91 203 8.0E-06
sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens GN=TRIP6 PE=1 SV=3 91 203 8.0E-06
sp|Q2YDK0|FHL5_BOVIN Four and a half LIM domains protein 5 OS=Bos taurus GN=FHL5 PE=2 SV=1 110 243 8.0E-06
sp|Q54BP9|GACV_DICDI Rho GTPase-activating protein gacV OS=Dictyostelium discoideum GN=gacV PE=3 SV=1 812 916 8.0E-06
sp|A5H447|ZYX_XENLA Zyxin OS=Xenopus laevis GN=zyx PE=1 SV=1 90 225 8.0E-06
sp|Q4R7A4|FHL5_MACFA Four and a half LIM domains protein 5 OS=Macaca fascicularis GN=FHL5 PE=2 SV=1 91 243 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9847
MAPDRDHGDRAMGPDAVTPPGDRSRPNGGGQKTPDSLYGLKPAASGSASAFSPGAAPPAVWPDDTPSRKSEERNR
SRPRNGRNASGQTRICKRCGEPLTGQFVRALDGTFHLDCFKCQDCGQIVASKFFPAEDENGQGQYPLCETDYFRR
LGLLCHQCGGALRGSYITALDRKYHVDHFTCSLCSTVFGAQDSYYEHDGNVYCHYHYSTRFAQRCNGCQTAILKQ
FVEIYRNGQNQHWHPECYMIHKFWNVRLAQPTDGRLPAREPDEPANRDLIRDQEERMEEKVYRIWSVLSTFEESS
AACISDMLLHVSNGAYVDGVLVAKRFIWHVEVLFQSADRLDAMMLSRNSKGMSYGREAKLLCKKIVAFFSLLSKT
QDTSVRKLGVTQELLSLVTGLAHYLKLLIRICLQGSLRLERESGNSDGLDQLLNDLADFETYKADENLLQKTMGG
ARLSAKDSDHCALCGRSVEDECARCGDTRWHLACLKCTRCARELGRCLAEARLKLLERKIYCKACATFGADGSPH
FEHITKLQQYVFLLKVALARLLDILRSNGSLPYSSEDCNASERGGAGADGGRLGAGPPFLNADARSKSYAGGGDK
EHHRESTYENTLNEVRRLRSTRLDRHLSSSVRQARTSRVMDADGRGPRPGSADGLESGPEAQGSTDIMFGQNEAI
TLDDIPRIVAVEQSREQQQQQRDRNPRQDPFGRSHAAAEAARSPVHQRTQSASRDADVRGGDPLTARVVRKFFPE
LSGLEYFNVRHLAVLTMQPMVEQEFALDELLGFIESRKQATFWKNLGKAFKNDKSKSVKKKGVFGVPLEMIIERD
GADSTDGVGPGTLRIPAIVDDVISSMRKMDLSVEGVFRKNGNIKKQQELVDRINADGCDVVNFMEQPVVQLAALL
KRYLRDLPDPLMTHKLYRLWVSAAKISDAERRKQCLHLTCCLLPKSHRDCLEILFTFLKWAGSFHQLDEEVGSKM
DIRNLATVIAPNILTNPNKALTLDSEAIFVIDAVEILITNIEEMCQVPDELLTLLNDPYLFSNSGEITTKEILRR
FQDRRGQVSTAEVGEVFSRHDTSTRSPPRRVETDPSVLQGERTVRPVQDPSMPVYSGHGTPPQQKWAGGGGGGGG
SEHASPYSDSRFNRSDGQLDSSEHSQRGEWRNSAWGRRGGGVGVGGNS*
Coding >Hirsu2|9847
ATGGCCCCGGACCGCGACCACGGCGACCGCGCGATGGGCCCCGACGCCGTCACGCCCCCGGGCGACAGGAGCCGG
CCCAACGGCGGCGGCCAGAAGACGCCCGATAGCCTCTACGGCCTCAAGCCCGCCGCCTCGGGCTCCGCCTCCGCC
TTTTCGCCCGGCGCCGCTCCGCCGGCCGTCTGGCCCGACGACACGCCGTCCCGCAAGAGCGAGGAGAGGAACCGG
TCGCGTCCGAGGAACGGGCGGAACGCGAGCGGCCAGACGCGCATCTGCAAGCGCTGCGGCGAGCCCCTGACCGGC
CAGTTTGTGCGGGCCCTGGACGGCACCTTTCACCTCGACTGCTTCAAGTGCCAGGACTGCGGCCAAATCGTGGCG
TCCAAGTTCTTCCCGGCCGAGGACGAGAACGGCCAGGGCCAGTACCCCCTCTGCGAGACCGACTACTTCCGACGC
CTGGGCCTGCTCTGCCACCAGTGCGGCGGCGCCCTGCGCGGCTCCTACATCACCGCCCTGGACCGAAAGTACCAC
GTCGACCACTTCACCTGCTCGCTCTGCTCCACCGTCTTCGGCGCCCAGGACAGCTACTACGAACACGACGGCAAC
GTCTACTGCCACTATCACTACTCGACCCGCTTTGCCCAGAGGTGCAACGGTTGCCAGACGGCCATCCTGAAGCAG
TTTGTCGAGATCTACCGGAACGGGCAGAACCAACACTGGCATCCCGAGTGTTACATGATACACAAGTTCTGGAAT
GTGCGCCTGGCCCAGCCAACAGACGGCCGCCTGCCCGCCCGCGAGCCCGACGAGCCGGCCAACAGGGACCTGATC
CGGGACCAGGAGGAGCGCATGGAGGAGAAGGTGTATCGGATATGGAGCGTCCTCTCCACCTTCGAGGAGTCGTCC
GCTGCCTGCATCTCCGACATGCTCCTGCACGTCAGCAACGGGGCCTACGTCGACGGCGTCCTGGTCGCTAAGCGC
TTCATATGGCACGTCGAGGTCCTCTTCCAGTCTGCCGACAGGCTCGACGCCATGATGCTCAGCCGCAACAGCAAA
GGCATGTCGTACGGGCGGGAGGCCAAGCTTCTCTGTAAGAAGATTGTCGCTTTCTTCTCGCTGCTGTCCAAGACG
CAGGACACCAGTGTCCGGAAGCTGGGCGTCACCCAGGAGCTGCTGTCCCTCGTCACGGGGCTGGCCCACTATCTG
AAGCTCCTGATACGAATCTGCCTCCAGGGGTCGCTCCGTCTCGAGCGGGAGTCGGGCAACAGCGACGGCCTGGAC
CAGCTGCTCAACGACCTCGCCGACTTCGAGACGTACAAGGCCGACGAGAACCTGCTGCAGAAGACCATGGGCGGC
GCGCGCCTGTCGGCCAAGGACTCGGACCACTGCGCCCTCTGCGGCCGGTCCGTCGAGGACGAGTGCGCCCGCTGC
GGCGACACGAGGTGGCACCTGGCCTGCCTCAAGTGCACGCGGTGCGCCCGCGAGCTGGGACGGTGCCTGGCCGAG
GCCCGCCTGAAGCTCCTCGAGCGCAAGATATACTGCAAGGCCTGCGCCACCTTCGGCGCCGACGGCTCGCCGCAC
TTTGAGCACATCACCAAGCTGCAGCAGTACGTCTTCCTGCTCAAGGTCGCCCTGGCGCGCCTGCTCGACATCCTC
CGCAGCAACGGCTCCCTGCCGTACTCGTCCGAGGACTGCAACGCCAGCGAGCGGGGCGGCGCGGGGGCCGACGGG
GGCCGGCTCGGGGCCGGGCCCCCCTTCCTCAACGCCGACGCGAGGTCCAAGTCGTACGCGGGCGGGGGCGACAAG
GAGCACCACCGCGAGTCGACGTACGAGAACACGCTCAACGAGGTCAGGCGGCTGCGCAGCACGCGGCTCGACCGC
CACCTGTCGTCCAGCGTTAGGCAGGCTCGGACGTCGCGGGTCATGGATGCCGACGGCCGCGGTCCCCGTCCCGGC
TCGGCCGACGGGCTCGAATCGGGGCCCGAGGCCCAGGGGTCGACCGACATCATGTTCGGCCAGAACGAGGCCATC
ACGCTCGACGACATCCCCCGCATCGTCGCCGTCGAGCAGTCGCGCGAGCAGCAGCAGCAGCAGCGCGACCGCAAC
CCGCGACAGGACCCCTTCGGCCGGTCGCACGCCGCCGCCGAGGCCGCCCGGTCCCCCGTCCACCAGCGGACGCAG
TCGGCGAGCCGGGACGCCGACGTGCGCGGGGGCGACCCCCTGACGGCCCGCGTCGTCCGCAAGTTCTTCCCGGAG
CTGTCCGGGCTCGAGTACTTCAACGTCCGGCACCTGGCCGTGCTGACGATGCAGCCGATGGTGGAGCAGGAGTTC
GCGCTGGACGAGCTGCTCGGCTTCATCGAGTCGCGGAAGCAGGCGACGTTCTGGAAGAACCTGGGCAAGGCCTTC
AAGAACGACAAGAGCAAGAGCGTCAAGAAGAAGGGCGTCTTCGGCGTGCCGCTCGAGATGATCATCGAGCGCGAC
GGGGCCGACTCGACGGACGGCGTGGGCCCGGGAACGCTGCGCATCCCGGCCATCGTCGACGACGTCATCTCGTCG
ATGCGCAAGATGGACCTCTCCGTCGAGGGCGTCTTCCGCAAGAACGGCAACATCAAGAAGCAGCAGGAGCTCGTC
GACCGCATCAACGCCGACGGCTGCGACGTCGTCAACTTCATGGAGCAGCCGGTGGTGCAGCTGGCGGCGCTGCTG
AAGCGCTACCTGCGCGACCTGCCGGACCCGCTCATGACGCACAAGCTCTACCGGCTCTGGGTCAGCGCGGCCAAG
ATCTCGGACGCGGAGAGGCGGAAGCAGTGCCTGCACCTGACGTGCTGCCTGCTGCCCAAGAGCCACCGCGACTGC
CTCGAGATCCTCTTCACCTTCTTGAAGTGGGCCGGCTCGTTCCACCAGCTGGACGAGGAGGTCGGCTCCAAGATG
GACATCCGGAACCTGGCGACGGTCATTGCGCCCAACATCCTGACGAACCCCAACAAGGCCCTCACCCTCGACAGC
GAGGCCATATTCGTTATCGACGCGGTGGAGATACTCATTACGAACATAGAAGAGATGTGTCAGGTCCCGGACGAG
CTCCTCACCCTGTTGAACGACCCGTACCTCTTCAGCAACAGCGGCGAGATCACGACCAAGGAGATCCTGAGGCGC
TTCCAAGACCGACGGGGCCAGGTCTCGACGGCCGAGGTGGGCGAGGTGTTTAGTCGACACGACACGTCCACCCGG
TCTCCGCCCCGACGGGTCGAGACGGATCCTTCGGTGCTGCAGGGCGAGAGGACGGTCCGGCCCGTCCAGGACCCG
TCGATGCCCGTCTACAGCGGGCACGGCACGCCGCCGCAACAGAAGTGGGCCGGGGGCGGCGGCGGCGGCGGCGGC
AGCGAGCACGCATCCCCGTACAGCGACAGCCGCTTCAACCGCTCCGACGGCCAGCTGGACAGCTCGGAACACAGC
CAGCGCGGAGAGTGGCGGAACTCGGCCTGGGGCCGGCGGGGGGGCGGCGTCGGCGTCGGCGGCAACTCGTGA
Transcript >Hirsu2|9847
ATGGCCCCGGACCGCGACCACGGCGACCGCGCGATGGGCCCCGACGCCGTCACGCCCCCGGGCGACAGGAGCCGG
CCCAACGGCGGCGGCCAGAAGACGCCCGATAGCCTCTACGGCCTCAAGCCCGCCGCCTCGGGCTCCGCCTCCGCC
TTTTCGCCCGGCGCCGCTCCGCCGGCCGTCTGGCCCGACGACACGCCGTCCCGCAAGAGCGAGGAGAGGAACCGG
TCGCGTCCGAGGAACGGGCGGAACGCGAGCGGCCAGACGCGCATCTGCAAGCGCTGCGGCGAGCCCCTGACCGGC
CAGTTTGTGCGGGCCCTGGACGGCACCTTTCACCTCGACTGCTTCAAGTGCCAGGACTGCGGCCAAATCGTGGCG
TCCAAGTTCTTCCCGGCCGAGGACGAGAACGGCCAGGGCCAGTACCCCCTCTGCGAGACCGACTACTTCCGACGC
CTGGGCCTGCTCTGCCACCAGTGCGGCGGCGCCCTGCGCGGCTCCTACATCACCGCCCTGGACCGAAAGTACCAC
GTCGACCACTTCACCTGCTCGCTCTGCTCCACCGTCTTCGGCGCCCAGGACAGCTACTACGAACACGACGGCAAC
GTCTACTGCCACTATCACTACTCGACCCGCTTTGCCCAGAGGTGCAACGGTTGCCAGACGGCCATCCTGAAGCAG
TTTGTCGAGATCTACCGGAACGGGCAGAACCAACACTGGCATCCCGAGTGTTACATGATACACAAGTTCTGGAAT
GTGCGCCTGGCCCAGCCAACAGACGGCCGCCTGCCCGCCCGCGAGCCCGACGAGCCGGCCAACAGGGACCTGATC
CGGGACCAGGAGGAGCGCATGGAGGAGAAGGTGTATCGGATATGGAGCGTCCTCTCCACCTTCGAGGAGTCGTCC
GCTGCCTGCATCTCCGACATGCTCCTGCACGTCAGCAACGGGGCCTACGTCGACGGCGTCCTGGTCGCTAAGCGC
TTCATATGGCACGTCGAGGTCCTCTTCCAGTCTGCCGACAGGCTCGACGCCATGATGCTCAGCCGCAACAGCAAA
GGCATGTCGTACGGGCGGGAGGCCAAGCTTCTCTGTAAGAAGATTGTCGCTTTCTTCTCGCTGCTGTCCAAGACG
CAGGACACCAGTGTCCGGAAGCTGGGCGTCACCCAGGAGCTGCTGTCCCTCGTCACGGGGCTGGCCCACTATCTG
AAGCTCCTGATACGAATCTGCCTCCAGGGGTCGCTCCGTCTCGAGCGGGAGTCGGGCAACAGCGACGGCCTGGAC
CAGCTGCTCAACGACCTCGCCGACTTCGAGACGTACAAGGCCGACGAGAACCTGCTGCAGAAGACCATGGGCGGC
GCGCGCCTGTCGGCCAAGGACTCGGACCACTGCGCCCTCTGCGGCCGGTCCGTCGAGGACGAGTGCGCCCGCTGC
GGCGACACGAGGTGGCACCTGGCCTGCCTCAAGTGCACGCGGTGCGCCCGCGAGCTGGGACGGTGCCTGGCCGAG
GCCCGCCTGAAGCTCCTCGAGCGCAAGATATACTGCAAGGCCTGCGCCACCTTCGGCGCCGACGGCTCGCCGCAC
TTTGAGCACATCACCAAGCTGCAGCAGTACGTCTTCCTGCTCAAGGTCGCCCTGGCGCGCCTGCTCGACATCCTC
CGCAGCAACGGCTCCCTGCCGTACTCGTCCGAGGACTGCAACGCCAGCGAGCGGGGCGGCGCGGGGGCCGACGGG
GGCCGGCTCGGGGCCGGGCCCCCCTTCCTCAACGCCGACGCGAGGTCCAAGTCGTACGCGGGCGGGGGCGACAAG
GAGCACCACCGCGAGTCGACGTACGAGAACACGCTCAACGAGGTCAGGCGGCTGCGCAGCACGCGGCTCGACCGC
CACCTGTCGTCCAGCGTTAGGCAGGCTCGGACGTCGCGGGTCATGGATGCCGACGGCCGCGGTCCCCGTCCCGGC
TCGGCCGACGGGCTCGAATCGGGGCCCGAGGCCCAGGGGTCGACCGACATCATGTTCGGCCAGAACGAGGCCATC
ACGCTCGACGACATCCCCCGCATCGTCGCCGTCGAGCAGTCGCGCGAGCAGCAGCAGCAGCAGCGCGACCGCAAC
CCGCGACAGGACCCCTTCGGCCGGTCGCACGCCGCCGCCGAGGCCGCCCGGTCCCCCGTCCACCAGCGGACGCAG
TCGGCGAGCCGGGACGCCGACGTGCGCGGGGGCGACCCCCTGACGGCCCGCGTCGTCCGCAAGTTCTTCCCGGAG
CTGTCCGGGCTCGAGTACTTCAACGTCCGGCACCTGGCCGTGCTGACGATGCAGCCGATGGTGGAGCAGGAGTTC
GCGCTGGACGAGCTGCTCGGCTTCATCGAGTCGCGGAAGCAGGCGACGTTCTGGAAGAACCTGGGCAAGGCCTTC
AAGAACGACAAGAGCAAGAGCGTCAAGAAGAAGGGCGTCTTCGGCGTGCCGCTCGAGATGATCATCGAGCGCGAC
GGGGCCGACTCGACGGACGGCGTGGGCCCGGGAACGCTGCGCATCCCGGCCATCGTCGACGACGTCATCTCGTCG
ATGCGCAAGATGGACCTCTCCGTCGAGGGCGTCTTCCGCAAGAACGGCAACATCAAGAAGCAGCAGGAGCTCGTC
GACCGCATCAACGCCGACGGCTGCGACGTCGTCAACTTCATGGAGCAGCCGGTGGTGCAGCTGGCGGCGCTGCTG
AAGCGCTACCTGCGCGACCTGCCGGACCCGCTCATGACGCACAAGCTCTACCGGCTCTGGGTCAGCGCGGCCAAG
ATCTCGGACGCGGAGAGGCGGAAGCAGTGCCTGCACCTGACGTGCTGCCTGCTGCCCAAGAGCCACCGCGACTGC
CTCGAGATCCTCTTCACCTTCTTGAAGTGGGCCGGCTCGTTCCACCAGCTGGACGAGGAGGTCGGCTCCAAGATG
GACATCCGGAACCTGGCGACGGTCATTGCGCCCAACATCCTGACGAACCCCAACAAGGCCCTCACCCTCGACAGC
GAGGCCATATTCGTTATCGACGCGGTGGAGATACTCATTACGAACATAGAAGAGATGTGTCAGGTCCCGGACGAG
CTCCTCACCCTGTTGAACGACCCGTACCTCTTCAGCAACAGCGGCGAGATCACGACCAAGGAGATCCTGAGGCGC
TTCCAAGACCGACGGGGCCAGGTCTCGACGGCCGAGGTGGGCGAGGTGTTTAGTCGACACGACACGTCCACCCGG
TCTCCGCCCCGACGGGTCGAGACGGATCCTTCGGTGCTGCAGGGCGAGAGGACGGTCCGGCCCGTCCAGGACCCG
TCGATGCCCGTCTACAGCGGGCACGGCACGCCGCCGCAACAGAAGTGGGCCGGGGGCGGCGGCGGCGGCGGCGGC
AGCGAGCACGCATCCCCGTACAGCGACAGCCGCTTCAACCGCTCCGACGGCCAGCTGGACAGCTCGGAACACAGC
CAGCGCGGAGAGTGGCGGAACTCGGCCTGGGGCCGGCGGGGGGGCGGCGTCGGCGTCGGCGGCAACTCGTGA
Gene >Hirsu2|9847
ATGGCCCCGGACCGCGACCACGGCGACCGCGCGATGGGCCCCGACGCCGTCACGCCCCCGGGCGACAGGAGCCGG
CCCAACGGCGGCGGCCAGAAGACGCCCGATAGCCTCTACGGCCTCAAGCCCGCCGCCTCGGGCTCCGCCTCCGCC
TTTTCGCCCGGCGCCGCTCCGCCGGCCGTCTGGCCCGACGACACGCCGTCCCGCAAGAGCGAGGAGAGGAACCGG
TCGCGTCCGAGGAACGGGCGGAACGCGAGCGGCCAGACGCGCATCTGCAAGCGCTGCGGCGAGCCCCTGACCGGC
CAGTTTGTGCGGGCCCTGGACGGCACCTTTCACCTCGACTGCTTCAAGTGCCAGGTATGTCCTGTCCCGTCCCGT
CCCGTCCCATCCTGTTCCTTTCCAAGCTGGCCAGCCTCATCCCTCGCATCGCACCCTGCTTCTGCTGCTCCTTCT
GCCTTGGCCACTTCTGCTTCCGCTGCTGACGCCGTTGGCCTCCCCCCCCCAAATGCAGGACTGCGGCCAAATCGT
GGCGTCCAAGTTCTTCCCGGCCGAGGACGAGAACGGCCAGGGCCAGTACCCCCTCTGCGAGACCGACTACTTCCG
ACGCCTGGGCCTGCTCTGCCACCAGTGCGGCGGCGCCCTGCGCGGCTCCTACATCACCGCCCTGGACCGAAAGTA
CCACGTCGACCACTTCACCTGCTCGCTCTGCTCCACCGTCTTCGGCGCCCAGGACAGCTACTACGAACACGACGG
CAACGTCTACTGCCACTATCACTACTCGACCCGCTTTGCCCAGAGGTGCAACGGTTGCCAGACGGCCATCCTGAA
GCAGTTTGTCGAGATCTACCGGAACGGGCAGAACCAACACTGGCATCCCGAGTGTTACATGATACACAAGTTCTG
GAATGTGCGCCTGGCCCAGCCAACAGACGGCCGCCTGCCCGCCCGCGAGCCCGACGAGCCGGCCAACAGGGACCT
GATCCGGGACCAGGAGGAGCGCATGGAGGAGAAGGTGTATCGGATATGGAGCGTCCTCTCCACCTTCGAGGAGTC
GTCCGCTGCCTGCATCTCCGACATGCTCCTGCACGTCAGCAACGGGGCCTACGTCGACGGCGTCCTGGTCGCTAA
GCGCTTCATATGGCACGTCGAGGTCCTCTTCCAGTCTGCCGACAGGCTCGACGCCATGATGCTCAGCCGCAACAG
CAAAGGTGAGTCGGCTCGTCGCCCTCCCCCAAGCCCCCGAGCCCCACCGCGAGCAGAGAGCGCGCCCGCGGCGGC
CGAACCGGCCCGCTGACCCCGGGGCCCCTCCCCGTCTCTACCTTCCAGGCATGTCGTACGGGCGGGAGGCCAAGC
TTCTCTGTAAGAAGATTGTCGCTTTCTTCTCGCTGCTGTCCAAGACGCAGGACACCAGTGTCCGGAAGCTGGGCG
TCACCCAGGAGCTGCTGTCCCTCGTCACGGGGCTGGCCCACTATCTGAAGCTCCTGATACGAATCTGCCTCCAGG
GGTCGCTCCGTCTCGAGCGGGAGTCGGGCAACAGCGACGGCCTGGACCAGCTGCTCAACGACCTCGCCGACTTCG
AGACGTACAAGGCCGACGAGAACCTGCTGCAGAAGACCATGGGCGGCGCGCGCCTGTCGGCCAAGGACTCGGACC
ACTGCGCCCTCTGCGGCCGGTCCGTCGAGGACGAGTGCGCCCGCTGCGGCGACACGAGGTGGCACCTGGCCTGCC
TCAAGTGCACGCGGTGCGCCCGCGAGCTGGGACGGTGCCTGGCCGAGGCCCGCCTGAAGCTCCTCGAGCGCAAGA
TATACTGCAAGGCCTGCGCCACCTTCGGCGCCGACGGCTCGCCGCACTTTGAGCACATCACCAAGCTGCAGCAGT
ACGTCTTCCTGCTCAAGGTCGCCCTGGCGCGCCTGCTCGACATCCTCCGCAGCAACGGCTCCCTGCCGTACTCGT
CCGAGGACTGCAACGCCAGCGAGCGGGGCGGCGCGGGGGCCGACGGGGGCCGGCTCGGGGCCGGGCCCCCCTTCC
TCAACGCCGACGCGAGGTCCAAGTCGTACGCGGGCGGGGGCGACAAGGAGCACCACCGCGAGTCGACGTACGAGA
ACACGCTCAACGAGGTCAGGCGGCTGCGCAGCACGCGGCTCGACCGCCACCTGTCGTCCAGCGTTAGGCAGGCTC
GGACGTCGCGGGTCATGGATGCCGACGGCCGCGGTCCCCGTCCCGGCTCGGCCGACGGGCTCGAATCGGGGCCCG
AGGCCCAGGGGTCGACCGACATCATGTTCGGCCAGAACGAGGCCATCACGCTCGACGACATCCCCCGCATCGTCG
CCGTCGAGCAGTCGCGCGAGCAGCAGCAGCAGCAGCGCGACCGCAACCCGCGACAGGACCCCTTCGGCCGGTCGC
ACGCCGCCGCCGAGGCCGCCCGGTCCCCCGTCCACCAGCGGACGCAGTCGGCGAGCCGGGACGCCGACGTGCGCG
GGGGCGACCCCCTGACGGCCCGCGTCGTCCGCAAGTTCTTCCCGGAGCTGTCCGGGCTCGAGTACTTCAACGTCC
GGCACCTGGCCGTGCTGACGATGCAGCCGATGGTGGAGCAGGAGTTCGCGCTGGACGAGCTGCTCGGCTTCATCG
AGTCGCGGAAGCAGGCGACGTTCTGGAAGAACCTGGGCAAGGCCTTCAAGAACGACAAGAGCAAGAGCGTCAAGA
AGAAGGGCGTCTTCGGCGTGCCGCTCGAGATGATCATCGAGCGCGACGGGGCCGACTCGACGGACGGCGTGGGCC
CGGGAACGCTGCGCATCCCGGCCATCGTCGACGACGTCATCTCGTCGATGCGCAAGATGGACCTCTCCGTCGAGG
GCGTCTTCCGCAAGAACGGCAACATCAAGAAGCAGCAGGAGCTCGTCGACCGCATCAACGCCGACGGCTGCGACG
TCGTCAACTTCATGGAGCAGCCGGTGGTGCAGCTGGCGGCGCTGCTGAAGCGCTACCTGCGCGACCTGCCGGACC
CGCTCATGACGCACAAGCTCTACCGGCTCTGGGTCAGCGCGGCCAAGATCTCGGACGCGGAGAGGCGGAAGCAGT
GCCTGCACCTGACGTGCTGCCTGCTGCCCAAGAGCCACCGCGACTGCCTCGAGATCCTCTTCACCTTCTTGAAGT
GGGCCGGCTCGTTCCACCAGCTGGACGAGGAGGTCGGCTCCAAGATGGACATCCGGAACCTGGCGACGGTCATTG
CGCCCAACATCCTGACGAACCCCAACAAGGCCCTCACCCTCGACAGCGAGGCCATATTCGTTATCGACGCGGTGG
AGATACTCATTACGAACATAGAAGAGATGTGTCAGGTATGTCGTCACCGCCCCCCTCCTCTCTGTCACGTCTTCT
CTCTTCTGGCCGACGACGACGCGCGCAGGACCGACTGACGACGGCTTCGCAGGTCCCGGACGAGCTCCTCACCCT
GTTGAACGACCCGTACCTCTTCAGCAACAGCGGCGAGATCACGACCAAGGAGATCCTGAGGCGCTTCCAAGACCG
ACGGGGCCAGGTCTCGACGGCCGAGGTGGGCGAGGTGTTTAGTCGACACGACACGTCCACCCGGTCTCCGCCCCG
ACGGGTCGAGACGGATCCTTCGGTGCTGCAGGGCGAGAGGACGGTCCGGCCCGTCCAGGACCCGTCGATGCCCGT
CTACAGCGGGCACGGCACGCCGCCGCAACAGAAGTGGGCCGGGGGCGGCGGCGGCGGCGGCGGCAGCGAGCACGC
ATCCCCGTACAGCGACAGCCGCTTCAACCGCTCCGACGGCCAGCTGGACAGCTCGGAACACAGCCAGCGCGGAGA
GTGGCGGAACTCGGCCTGGGGCCGGCGGGGGGGCGGCGTCGGCGTCGGCGGCAACTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail