Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9841
Gene name
LocationContig_746:6308..7369
Strand-
Gene length (bp)1061
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13821 DUF4187 Domain of unknown function (DUF4187) 2.8E-20 284 335
PF01585 G-patch G-patch domain 3.2E-08 88 134

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6DGZ0|GPT11_DANRE G patch domain-containing protein 11 OS=Danio rerio GN=gpatch11 PE=2 SV=1 21 214 3.0E-15
sp|Q3UFS4|GPT11_MOUSE G patch domain-containing protein 11 OS=Mus musculus GN=Gpatch11 PE=1 SV=2 23 192 3.0E-09
sp|Q8N954|GPT11_HUMAN G patch domain-containing protein 11 OS=Homo sapiens GN=GPATCH11 PE=1 SV=3 23 192 6.0E-09
sp|Q2KI19|GPT11_BOVIN G patch domain-containing protein 11 OS=Bos taurus GN=GPATCH11 PE=2 SV=2 23 200 8.0E-09
sp|Q6DF57|GPT11_XENTR G patch domain-containing protein 11 OS=Xenopus tropicalis GN=gpatch11 PE=2 SV=1 20 208 1.0E-08

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9841
MTSKTPSGKGADMTGRDGSEDGEDDYMSMTFAEPDKPNESSLQRTQRLKRESQARGFTKSKAQLAEEEAEARKKA
LSRSLLDDPRAKQSKGLAMMAKMGFTGGGLGKKTDQGASSGRTEPIMVSVKEDRGGIGLDSENKRRLQEEEAQRE
AKAVKVEPMDPEQYRERAGRERDEARREKQFHAAQRLIERLDEDEVPGTPARPQPIPRDASSRPLKAIPLVYRGL
VRFREEQQHDQLRRRELEQSISRYPRYDDPEADEDDKMALGQQEMKPLAAADDLHEEDEELEKFNALDAGERLRR
AVDYLRQNHHYCFWCKMAYPNAQLEGCPGLTEDDHE*
Coding >Hirsu2|9841
ATGACATCAAAGACGCCATCAGGCAAGGGCGCCGACATGACAGGTCGTGACGGCAGCGAGGACGGCGAGGATGAC
TATATGAGCATGACGTTTGCAGAACCAGACAAGCCCAATGAGAGCTCCCTGCAGCGGACCCAGCGCCTGAAGCGC
GAGTCTCAGGCCCGCGGCTTCACCAAGTCCAAGGCGCAGCTCGCGGAGGAGGAAGCAGAGGCCCGGAAGAAGGCC
CTGTCCAGGTCGCTGCTCGACGACCCGCGGGCCAAGCAGAGCAAGGGCCTGGCTATGATGGCCAAGATGGGCTTC
ACCGGCGGCGGCCTGGGCAAGAAGACGGACCAGGGCGCCTCGTCCGGCCGGACCGAGCCCATCATGGTCAGCGTC
AAGGAGGACCGCGGCGGCATCGGGCTCGACAGCGAGAACAAGCGGCGGCTGCAGGAGGAGGAGGCGCAGCGGGAG
GCCAAGGCCGTCAAGGTGGAGCCGATGGACCCGGAGCAGTACCGCGAGCGCGCCGGCAGGGAGCGCGACGAGGCC
AGGCGCGAGAAGCAGTTCCACGCGGCCCAGCGCCTCATCGAGCGCCTGGACGAGGACGAGGTCCCGGGCACGCCC
GCCCGCCCGCAGCCGATCCCCCGCGACGCGTCCTCGCGCCCGCTCAAGGCGATCCCCCTCGTCTACCGCGGCCTC
GTCCGCTTCCGCGAGGAGCAGCAGCACGACCAGCTCCGGCGACGCGAGCTCGAGCAGTCCATCTCGCGCTACCCC
CGCTACGACGACCCGGAGGCCGACGAGGACGACAAGATGGCCCTCGGCCAGCAGGAGATGAAGCCGCTCGCCGCC
GCGGACGACCTGCACGAGGAGGACGAGGAGCTCGAGAAGTTCAACGCGCTCGACGCCGGCGAGCGATTGCGCAGG
GCCGTCGACTACCTGCGCCAGAACCACCACTACTGCTTCTGGTGCAAGATGGCCTATCCCAACGCGCAGTTAGAG
GGGTGCCCAGGCCTAACAGAGGACGATCACGAGTAA
Transcript >Hirsu2|9841
ATGACATCAAAGACGCCATCAGGCAAGGGCGCCGACATGACAGGTCGTGACGGCAGCGAGGACGGCGAGGATGAC
TATATGAGCATGACGTTTGCAGAACCAGACAAGCCCAATGAGAGCTCCCTGCAGCGGACCCAGCGCCTGAAGCGC
GAGTCTCAGGCCCGCGGCTTCACCAAGTCCAAGGCGCAGCTCGCGGAGGAGGAAGCAGAGGCCCGGAAGAAGGCC
CTGTCCAGGTCGCTGCTCGACGACCCGCGGGCCAAGCAGAGCAAGGGCCTGGCTATGATGGCCAAGATGGGCTTC
ACCGGCGGCGGCCTGGGCAAGAAGACGGACCAGGGCGCCTCGTCCGGCCGGACCGAGCCCATCATGGTCAGCGTC
AAGGAGGACCGCGGCGGCATCGGGCTCGACAGCGAGAACAAGCGGCGGCTGCAGGAGGAGGAGGCGCAGCGGGAG
GCCAAGGCCGTCAAGGTGGAGCCGATGGACCCGGAGCAGTACCGCGAGCGCGCCGGCAGGGAGCGCGACGAGGCC
AGGCGCGAGAAGCAGTTCCACGCGGCCCAGCGCCTCATCGAGCGCCTGGACGAGGACGAGGTCCCGGGCACGCCC
GCCCGCCCGCAGCCGATCCCCCGCGACGCGTCCTCGCGCCCGCTCAAGGCGATCCCCCTCGTCTACCGCGGCCTC
GTCCGCTTCCGCGAGGAGCAGCAGCACGACCAGCTCCGGCGACGCGAGCTCGAGCAGTCCATCTCGCGCTACCCC
CGCTACGACGACCCGGAGGCCGACGAGGACGACAAGATGGCCCTCGGCCAGCAGGAGATGAAGCCGCTCGCCGCC
GCGGACGACCTGCACGAGGAGGACGAGGAGCTCGAGAAGTTCAACGCGCTCGACGCCGGCGAGCGATTGCGCAGG
GCCGTCGACTACCTGCGCCAGAACCACCACTACTGCTTCTGGTGCAAGATGGCCTATCCCAACGCGCAGTTAGAG
GGGTGCCCAGGCCTAACAGAGGACGATCACGAGTAA
Gene >Hirsu2|9841
ATGACATCAAAGAGTGAGCGACATCAGCGTCGGGAGCGGCAACGCGGGCTTACCATCCTCCAGCGCCATCAGGCA
AGGGCGCCGACATGACAGGTCGTGACGGCAGCGAGGACGGCGAGGATGACTATATGAGCATGACGTTTGCAGAAC
CAGACAAGCCCAATGAGAGCTCCCTGCAGCGGACCCAGCGCCTGAAGCGCGAGTCTCAGGCCCGCGGCTTCACCA
AGTCCAAGGCGCAGCTCGCGGAGGAGGAAGCAGAGGCCCGGAAGAAGGCCCTGTCCAGGTCGCTGCTCGACGACC
CGCGGGCCAAGCAGAGCAAGGGCCTGGCTATGATGGCCAAGATGGGCTTCACCGGCGGCGGCCTGGGCAAGAAGA
CGGACCAGGGCGCCTCGTCCGGCCGGACCGAGCCCATCATGGTCAGCGTCAAGGAGGACCGCGGCGGCATCGGGC
TCGACAGCGAGAACAAGCGGCGGCTGCAGGAGGAGGAGGCGCAGCGGGAGGCCAAGGCCGTCAAGGTGGAGCCGA
TGGACCCGGAGCAGTACCGCGAGCGCGCCGGCAGGGAGCGCGACGAGGCCAGGCGCGAGAAGCAGTTCCACGCGG
CCCAGCGCCTCATCGAGCGCCTGGACGAGGACGAGGTCCCGGGCACGCCCGCCCGCCCGCAGCCGATCCCCCGCG
ACGCGTCCTCGCGCCCGCTCAAGGCGATCCCCCTCGTCTACCGCGGCCTCGTCCGCTTCCGCGAGGAGCAGCAGC
ACGACCAGCTCCGGCGACGCGAGCTCGAGCAGTCCATCTCGCGCTACCCCCGCTACGACGACCCGGAGGCCGACG
AGGACGACAAGATGGCCCTCGGCCAGCAGGAGATGAAGCCGCTCGCCGCCGCGGACGACCTGCACGAGGAGGACG
AGGAGCTCGAGAAGTTCAACGCGCTCGACGCCGGCGAGCGATTGCGCAGGGCCGTCGACTACCTGCGCCAGAACC
ACCACTACTGCTTCTGGTGCAAGATGGCCTATCCCAACGCGCAGTTAGAGGGGTGCCCAGGCCTAACAGAGGACG
ATCACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail