Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|984
Gene name
LocationContig_1202:4337..8202
Strand-
Gene length (bp)3865
Transcript length (bp)3627
Coding sequence length (bp)3627
Protein length (aa) 1209

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02194 PXA PXA domain 1.3E-50 48 231
PF08628 Nexin_C Sorting nexin C terminal 2.5E-24 1076 1186
PF00787 PX PX domain 1.2E-18 866 966
PF00615 RGS Regulator of G protein signaling domain 1.4E-14 370 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN1|SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snx12 PE=3 SV=1 765 1201 2.0E-54
sp|Q01846|MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM1 PE=1 SV=3 739 1201 2.0E-50
sp|Q9USN1|SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snx12 PE=3 SV=1 62 519 5.0E-46
sp|Q01846|MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM1 PE=1 SV=3 47 522 1.0E-23
sp|Q9H3E2|SNX25_HUMAN Sorting nexin-25 OS=Homo sapiens GN=SNX25 PE=1 SV=2 865 1191 7.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN1|SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snx12 PE=3 SV=1 765 1201 2.0E-54
sp|Q01846|MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM1 PE=1 SV=3 739 1201 2.0E-50
sp|Q9USN1|SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snx12 PE=3 SV=1 62 519 5.0E-46
sp|Q01846|MDM1_YEAST Structural protein MDM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM1 PE=1 SV=3 47 522 1.0E-23
sp|Q9H3E2|SNX25_HUMAN Sorting nexin-25 OS=Homo sapiens GN=SNX25 PE=1 SV=2 865 1191 7.0E-22
sp|Q9Y5W8|SNX13_HUMAN Sorting nexin-13 OS=Homo sapiens GN=SNX13 PE=1 SV=4 868 1207 4.0E-21
sp|Q6PHS6|SNX13_MOUSE Sorting nexin-13 OS=Mus musculus GN=Snx13 PE=2 SV=1 868 1207 2.0E-20
sp|Q3ZT31|SNX25_MOUSE Sorting nexin-25 OS=Mus musculus GN=Snx25 PE=1 SV=3 865 1191 3.0E-20
sp|Q5R903|SNX14_PONAB Sorting nexin-14 OS=Pongo abelii GN=SNX14 PE=1 SV=1 48 229 3.0E-13
sp|Q9Y5W7|SNX14_HUMAN Sorting nexin-14 OS=Homo sapiens GN=SNX14 PE=1 SV=3 48 229 4.0E-13
sp|Q8BHY8|SNX14_MOUSE Sorting nexin-14 OS=Mus musculus GN=Snx14 PE=1 SV=2 47 229 8.0E-13
sp|Q6P4T1|SNX19_MOUSE Sorting nexin-19 OS=Mus musculus GN=Snx19 PE=1 SV=1 38 229 7.0E-11
sp|Q9Y5W8|SNX13_HUMAN Sorting nexin-13 OS=Homo sapiens GN=SNX13 PE=1 SV=4 11 513 3.0E-10
sp|Q6PHS6|SNX13_MOUSE Sorting nexin-13 OS=Mus musculus GN=Snx13 PE=2 SV=1 63 513 4.0E-10
sp|Q92543|SNX19_HUMAN Sorting nexin-19 OS=Homo sapiens GN=SNX19 PE=1 SV=2 55 229 1.0E-09
sp|Q5PNP1|SNX14_DANRE Sorting nexin-14 OS=Danio rerio GN=snx14 PE=2 SV=3 41 229 3.0E-09
sp|Q5PNP1|SNX14_DANRE Sorting nexin-14 OS=Danio rerio GN=snx14 PE=2 SV=3 873 1208 1.0E-08
sp|Q5R903|SNX14_PONAB Sorting nexin-14 OS=Pongo abelii GN=SNX14 PE=1 SV=1 864 1208 2.0E-07
sp|Q9Y5W7|SNX14_HUMAN Sorting nexin-14 OS=Homo sapiens GN=SNX14 PE=1 SV=3 864 1208 3.0E-07
sp|Q8C080|SNX16_MOUSE Sorting nexin-16 OS=Mus musculus GN=Snx16 PE=1 SV=2 866 964 1.0E-06
sp|P57769|SNX16_RAT Sorting nexin-16 OS=Rattus norvegicus GN=Snx16 PE=1 SV=2 866 964 4.0E-06
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 854 981 5.0E-06
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 854 981 5.0E-06
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 854 981 6.0E-06
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 854 981 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0008289 lipid binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005543 phospholipid binding No
GO:0043168 anion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|984
LLTARRPTTRPPPRPARLSFLEPRRWRAEVDALRRRQTYCRPTLEFASPRVAPAVDGLLDLILRDFVRSWYSHIS
RNPVFPNEVDRAVRLALSSLVRPLRERDLADVVTSRLVPILTTHFRDFYDAERSVRGRKLNRSVTESEELDLAIA
SKYRDGRLHPAASLTFPDTKMVQQEYLRSLVARIMPSVLPERMLSSRAVFALVREMVACALLFPVVQLLSDPDTW
NQLMESYGRSMLQDRSTVRRLRAALDQHAQPVPARSAKSAAAPPRIAPGDSERKFEKFIRAIRKVNNVSDARRFR
SEVSSQLKRDSLEDQQDPVYLRRLEMGKRLLDQRVGQLAAPSDHRAPASRPPRPPPPNPGAASRLQDASLVELLR
DSSGLSYFMEYMDRQHAMSLVQFWLVVDGFRNPLEDDGADEDEGDDGAPSSLPMWKDSDRVDLQQIHQAYLSKPE
LNVPESTKSTVRRFLKAGAAATPAQYHNARRSILKAQSAVLEEMQARYFQAFKKSDLYYKCLASQEASNASIPPT
PAPSGHGGPQLQQPQPQPQSNHAPNHSHPPVQRAAPSYQSRPKPVARLTTAPPEVMAARRCGSASDLRALHESHN
GGTDPLVASRRSLDEGSAGPIFSDDDLDHDGMLDSVQSLDAYAPARQPPDTQVVQAVEQALNNIMGDDRPQTAED
LRASLFGPDDADSGLFLGPENDSGRGSMDAGRAPSVLSKDAEKPSLSSLGLVSAASRIGVFVDDDLFGDDDNHVP
EECEEGEDGTGAAEDGDEVHEAAPGDLGLAEAIAALGSDIDRLVAQEAVVDSLTKKAELTNNTPELRILRKSKAS
LQREIRRKELQRQQYIVQESDNSLYGRSAIRIKSIQVGREEDGREFALYVVEVQRDAGEQMPAASWIVTRRYSEF
HDLHQKLRTGHPSVRNLEFPRRRMVMKFQSEFLRKRRTALEKYLRELLLLPDVCRSRELRAFLSQSIIAQGQDLS
DREDKKDMMTRLYDSVADGMDDILGNIPVLDQISVAGQNLIAAATSQLNAMPLNVGEDDGFPAAEAEAELNAFED
KELEPFIKPICDIFLEVFELNRGNNWLRGRAVVMVLQQLLGGTIERKVRDNVKVLVQEDSLLRYVGMVTDRLWPD
GELRRGEREAAGARGPAERKKTRTEASLMLATLVPDLAGSVVGRVNAQAASRRIFATFNNARLNAHLVFTVLDEI
VSVWFEQV*
Coding >Hirsu2|984
CTGCTGACGGCACGGCGGCCGACGACGCGCCCGCCGCCGAGGCCCGCCCGCCTTTCCTTCCTCGAGCCGCGGCGG
TGGCGGGCCGAGGTCGACGCCCTGCGCCGCCGACAGACGTACTGCCGGCCGACGCTCGAGTTCGCATCGCCGCGC
GTGGCCCCGGCCGTGGACGGCCTGCTCGACCTGATACTGCGCGACTTCGTGCGCTCCTGGTACTCGCACATCAGC
CGAAACCCCGTCTTCCCGAACGAGGTCGATCGAGCGGTCCGCCTGGCCCTGTCCAGCCTCGTCCGGCCGCTCCGC
GAGAGGGACCTGGCCGACGTGGTCACGAGCCGGCTGGTGCCCATCCTCACCACGCACTTCCGCGACTTCTACGAC
GCCGAGCGGTCGGTCCGCGGCCGCAAGCTCAACCGGTCCGTCACCGAGTCGGAGGAGCTGGACCTGGCCATCGCC
TCCAAATACCGCGACGGCCGGCTGCACCCGGCCGCCTCGCTCACCTTCCCCGACACCAAGATGGTCCAGCAGGAG
TACCTGCGGTCCCTGGTCGCCCGCATCATGCCGAGCGTGCTGCCGGAGCGGATGCTCTCGAGCCGGGCCGTCTTC
GCCCTCGTGCGCGAGATGGTCGCCTGCGCCCTCCTCTTCCCCGTCGTCCAGCTGCTGTCCGACCCGGACACGTGG
AACCAGCTGATGGAGAGCTACGGCCGCTCCATGCTGCAGGACCGCTCCACCGTCCGCCGGCTCCGCGCCGCCCTC
GACCAGCACGCCCAGCCCGTGCCGGCCCGGTCGGCCAAGTCGGCCGCCGCGCCGCCGCGCATCGCCCCGGGCGAC
AGCGAGCGCAAGTTCGAAAAGTTCATCCGCGCCATCCGCAAGGTCAACAACGTGTCGGACGCCCGCCGCTTCCGG
AGCGAGGTCAGCAGCCAGCTCAAGCGCGACTCGCTCGAGGACCAGCAGGACCCGGTCTACCTGCGCCGCCTGGAG
ATGGGCAAGAGGCTGCTCGACCAGCGCGTCGGCCAGCTCGCCGCCCCCAGCGACCACCGCGCCCCGGCCTCCCGC
CCGCCCCGGCCCCCGCCGCCCAACCCCGGTGCCGCCTCGCGCCTCCAGGACGCGTCCCTGGTCGAGCTGCTCCGG
GACTCGTCCGGGCTGTCGTACTTCATGGAGTACATGGACCGCCAGCACGCCATGTCGCTCGTCCAGTTCTGGCTC
GTCGTCGACGGCTTCCGAAACCCGCTCGAGGACGACGGGGCCGACGAGGACGAGGGCGACGACGGGGCCCCGTCC
AGCCTGCCCATGTGGAAGGACTCGGACCGGGTCGACCTGCAGCAGATCCACCAGGCCTACCTGTCCAAGCCCGAG
CTGAACGTGCCGGAATCGACCAAGAGCACGGTGCGCCGGTTCCTCAAGGCCGGCGCCGCCGCGACGCCCGCGCAG
TATCACAACGCCCGGCGATCCATCCTCAAGGCCCAGAGCGCCGTCCTCGAGGAGATGCAGGCCCGCTACTTCCAG
GCCTTCAAAAAGTCGGACCTGTACTACAAGTGCCTCGCGTCGCAAGAGGCGTCGAACGCCAGCATCCCGCCTACG
CCGGCCCCTTCGGGCCACGGAGGGCCACAACTACAACAACCACAACCACAACCACAATCAAACCATGCCCCCAAC
CATTCTCATCCGCCCGTGCAACGGGCAGCTCCTTCCTACCAGTCGAGGCCCAAACCCGTCGCCAGACTCACGACC
GCTCCACCCGAGGTCATGGCCGCCAGACGATGCGGCTCGGCCTCAGACTTGCGGGCATTGCACGAGAGCCACAAC
GGGGGGACAGACCCCCTGGTAGCCTCGCGGCGATCTCTGGATGAGGGCTCCGCCGGGCCCATCTTCAGCGACGAC
GACCTGGACCACGACGGCATGCTCGATTCGGTGCAGAGCCTGGACGCGTACGCGCCGGCGCGGCAGCCCCCGGAC
ACCCAGGTGGTGCAGGCCGTGGAGCAGGCCCTCAACAACATCATGGGCGACGACCGGCCGCAGACGGCCGAGGAC
CTGCGGGCCTCCCTTTTCGGGCCGGACGACGCCGACTCGGGCCTCTTCCTGGGACCCGAGAACGACTCGGGCCGC
GGGTCCATGGACGCCGGCCGCGCGCCCTCGGTCCTGAGCAAGGACGCGGAGAAGCCCAGCCTGTCGTCGCTGGGC
CTGGTCAGCGCCGCGTCGCGCATCGGCGTGTTCGTGGACGACGACCTGTTCGGAGACGACGACAACCACGTCCCG
GAGGAGTGCGAGGAGGGCGAAGACGGGACGGGCGCGGCCGAGGACGGGGACGAGGTGCACGAGGCCGCGCCCGGA
GACCTCGGGTTGGCCGAGGCCATCGCGGCCCTGGGCAGCGACATCGACCGCCTGGTGGCGCAGGAGGCCGTGGTG
GACTCGCTGACGAAGAAGGCGGAGCTCACGAACAACACGCCGGAGCTGCGGATCCTCCGCAAGTCCAAGGCCAGC
CTGCAGCGGGAGATACGGCGCAAGGAGCTCCAGCGGCAGCAGTACATCGTGCAGGAGAGCGACAACAGCCTGTAC
GGGCGCTCGGCCATCAGGATCAAGTCGATCCAGGTGGGCCGGGAGGAGGACGGGCGAGAGTTCGCGCTCTACGTG
GTCGAGGTGCAGCGCGACGCGGGGGAGCAGATGCCGGCGGCGTCGTGGATCGTCACGAGGCGGTACAGCGAGTTC
CACGACCTCCACCAGAAGCTGCGGACGGGGCACCCGTCGGTGAGGAACCTCGAGTTCCCGCGGCGGCGCATGGTG
ATGAAGTTCCAGAGCGAGTTCCTGCGCAAGAGGAGGACGGCGCTGGAGAAGTACCTGCGGGAACTTTTGCTGCTG
CCGGACGTGTGTCGCAGCCGCGAGCTGCGCGCGTTCCTGTCGCAGAGCATCATCGCGCAGGGCCAGGACCTGTCG
GACCGCGAGGACAAGAAGGACATGATGACGCGCCTGTACGACTCGGTCGCGGACGGCATGGACGACATCCTGGGC
AACATTCCCGTGCTGGACCAGATCTCGGTGGCGGGCCAGAACCTGATCGCGGCGGCGACGAGCCAGCTCAACGCG
ATGCCGCTCAACGTCGGCGAGGACGACGGCTTCCCGGCGGCCGAGGCCGAGGCGGAGCTCAACGCGTTCGAGGAC
AAGGAGCTCGAGCCCTTCATCAAGCCCATCTGCGACATCTTCCTCGAGGTCTTCGAGCTCAACAGGGGCAACAAC
TGGCTGCGCGGGAGGGCGGTCGTCATGGTGCTCCAGCAGCTGCTCGGCGGGACCATCGAGCGCAAGGTGCGCGAC
AACGTCAAGGTGCTGGTCCAGGAGGACTCGCTCCTGCGGTACGTCGGCATGGTCACGGACAGGCTGTGGCCGGAC
GGCGAGCTGCGGCGCGGCGAGCGCGAGGCCGCGGGGGCGCGGGGGCCGGCGGAGCGGAAGAAGACGCGAACGGAA
GCGAGCCTGATGCTTGCGACGCTGGTGCCGGACCTGGCCGGCAGCGTCGTCGGGCGCGTCAACGCGCAGGCCGCA
AGCCGGCGCATCTTTGCGACGTTTAACAACGCTCGACTCAATGCTCACCTCGTCTTCACCGTCCTCGACGAGATT
GTGTCAGTATGGTTCGAGCAAGTCTGA
Transcript >Hirsu2|984
CTGCTGACGGCACGGCGGCCGACGACGCGCCCGCCGCCGAGGCCCGCCCGCCTTTCCTTCCTCGAGCCGCGGCGG
TGGCGGGCCGAGGTCGACGCCCTGCGCCGCCGACAGACGTACTGCCGGCCGACGCTCGAGTTCGCATCGCCGCGC
GTGGCCCCGGCCGTGGACGGCCTGCTCGACCTGATACTGCGCGACTTCGTGCGCTCCTGGTACTCGCACATCAGC
CGAAACCCCGTCTTCCCGAACGAGGTCGATCGAGCGGTCCGCCTGGCCCTGTCCAGCCTCGTCCGGCCGCTCCGC
GAGAGGGACCTGGCCGACGTGGTCACGAGCCGGCTGGTGCCCATCCTCACCACGCACTTCCGCGACTTCTACGAC
GCCGAGCGGTCGGTCCGCGGCCGCAAGCTCAACCGGTCCGTCACCGAGTCGGAGGAGCTGGACCTGGCCATCGCC
TCCAAATACCGCGACGGCCGGCTGCACCCGGCCGCCTCGCTCACCTTCCCCGACACCAAGATGGTCCAGCAGGAG
TACCTGCGGTCCCTGGTCGCCCGCATCATGCCGAGCGTGCTGCCGGAGCGGATGCTCTCGAGCCGGGCCGTCTTC
GCCCTCGTGCGCGAGATGGTCGCCTGCGCCCTCCTCTTCCCCGTCGTCCAGCTGCTGTCCGACCCGGACACGTGG
AACCAGCTGATGGAGAGCTACGGCCGCTCCATGCTGCAGGACCGCTCCACCGTCCGCCGGCTCCGCGCCGCCCTC
GACCAGCACGCCCAGCCCGTGCCGGCCCGGTCGGCCAAGTCGGCCGCCGCGCCGCCGCGCATCGCCCCGGGCGAC
AGCGAGCGCAAGTTCGAAAAGTTCATCCGCGCCATCCGCAAGGTCAACAACGTGTCGGACGCCCGCCGCTTCCGG
AGCGAGGTCAGCAGCCAGCTCAAGCGCGACTCGCTCGAGGACCAGCAGGACCCGGTCTACCTGCGCCGCCTGGAG
ATGGGCAAGAGGCTGCTCGACCAGCGCGTCGGCCAGCTCGCCGCCCCCAGCGACCACCGCGCCCCGGCCTCCCGC
CCGCCCCGGCCCCCGCCGCCCAACCCCGGTGCCGCCTCGCGCCTCCAGGACGCGTCCCTGGTCGAGCTGCTCCGG
GACTCGTCCGGGCTGTCGTACTTCATGGAGTACATGGACCGCCAGCACGCCATGTCGCTCGTCCAGTTCTGGCTC
GTCGTCGACGGCTTCCGAAACCCGCTCGAGGACGACGGGGCCGACGAGGACGAGGGCGACGACGGGGCCCCGTCC
AGCCTGCCCATGTGGAAGGACTCGGACCGGGTCGACCTGCAGCAGATCCACCAGGCCTACCTGTCCAAGCCCGAG
CTGAACGTGCCGGAATCGACCAAGAGCACGGTGCGCCGGTTCCTCAAGGCCGGCGCCGCCGCGACGCCCGCGCAG
TATCACAACGCCCGGCGATCCATCCTCAAGGCCCAGAGCGCCGTCCTCGAGGAGATGCAGGCCCGCTACTTCCAG
GCCTTCAAAAAGTCGGACCTGTACTACAAGTGCCTCGCGTCGCAAGAGGCGTCGAACGCCAGCATCCCGCCTACG
CCGGCCCCTTCGGGCCACGGAGGGCCACAACTACAACAACCACAACCACAACCACAATCAAACCATGCCCCCAAC
CATTCTCATCCGCCCGTGCAACGGGCAGCTCCTTCCTACCAGTCGAGGCCCAAACCCGTCGCCAGACTCACGACC
GCTCCACCCGAGGTCATGGCCGCCAGACGATGCGGCTCGGCCTCAGACTTGCGGGCATTGCACGAGAGCCACAAC
GGGGGGACAGACCCCCTGGTAGCCTCGCGGCGATCTCTGGATGAGGGCTCCGCCGGGCCCATCTTCAGCGACGAC
GACCTGGACCACGACGGCATGCTCGATTCGGTGCAGAGCCTGGACGCGTACGCGCCGGCGCGGCAGCCCCCGGAC
ACCCAGGTGGTGCAGGCCGTGGAGCAGGCCCTCAACAACATCATGGGCGACGACCGGCCGCAGACGGCCGAGGAC
CTGCGGGCCTCCCTTTTCGGGCCGGACGACGCCGACTCGGGCCTCTTCCTGGGACCCGAGAACGACTCGGGCCGC
GGGTCCATGGACGCCGGCCGCGCGCCCTCGGTCCTGAGCAAGGACGCGGAGAAGCCCAGCCTGTCGTCGCTGGGC
CTGGTCAGCGCCGCGTCGCGCATCGGCGTGTTCGTGGACGACGACCTGTTCGGAGACGACGACAACCACGTCCCG
GAGGAGTGCGAGGAGGGCGAAGACGGGACGGGCGCGGCCGAGGACGGGGACGAGGTGCACGAGGCCGCGCCCGGA
GACCTCGGGTTGGCCGAGGCCATCGCGGCCCTGGGCAGCGACATCGACCGCCTGGTGGCGCAGGAGGCCGTGGTG
GACTCGCTGACGAAGAAGGCGGAGCTCACGAACAACACGCCGGAGCTGCGGATCCTCCGCAAGTCCAAGGCCAGC
CTGCAGCGGGAGATACGGCGCAAGGAGCTCCAGCGGCAGCAGTACATCGTGCAGGAGAGCGACAACAGCCTGTAC
GGGCGCTCGGCCATCAGGATCAAGTCGATCCAGGTGGGCCGGGAGGAGGACGGGCGAGAGTTCGCGCTCTACGTG
GTCGAGGTGCAGCGCGACGCGGGGGAGCAGATGCCGGCGGCGTCGTGGATCGTCACGAGGCGGTACAGCGAGTTC
CACGACCTCCACCAGAAGCTGCGGACGGGGCACCCGTCGGTGAGGAACCTCGAGTTCCCGCGGCGGCGCATGGTG
ATGAAGTTCCAGAGCGAGTTCCTGCGCAAGAGGAGGACGGCGCTGGAGAAGTACCTGCGGGAACTTTTGCTGCTG
CCGGACGTGTGTCGCAGCCGCGAGCTGCGCGCGTTCCTGTCGCAGAGCATCATCGCGCAGGGCCAGGACCTGTCG
GACCGCGAGGACAAGAAGGACATGATGACGCGCCTGTACGACTCGGTCGCGGACGGCATGGACGACATCCTGGGC
AACATTCCCGTGCTGGACCAGATCTCGGTGGCGGGCCAGAACCTGATCGCGGCGGCGACGAGCCAGCTCAACGCG
ATGCCGCTCAACGTCGGCGAGGACGACGGCTTCCCGGCGGCCGAGGCCGAGGCGGAGCTCAACGCGTTCGAGGAC
AAGGAGCTCGAGCCCTTCATCAAGCCCATCTGCGACATCTTCCTCGAGGTCTTCGAGCTCAACAGGGGCAACAAC
TGGCTGCGCGGGAGGGCGGTCGTCATGGTGCTCCAGCAGCTGCTCGGCGGGACCATCGAGCGCAAGGTGCGCGAC
AACGTCAAGGTGCTGGTCCAGGAGGACTCGCTCCTGCGGTACGTCGGCATGGTCACGGACAGGCTGTGGCCGGAC
GGCGAGCTGCGGCGCGGCGAGCGCGAGGCCGCGGGGGCGCGGGGGCCGGCGGAGCGGAAGAAGACGCGAACGGAA
GCGAGCCTGATGCTTGCGACGCTGGTGCCGGACCTGGCCGGCAGCGTCGTCGGGCGCGTCAACGCGCAGGCCGCA
AGCCGGCGCATCTTTGCGACGTTTAACAACGCTCGACTCAATGCTCACCTCGTCTTCACCGTCCTCGACGAGATT
GTGTCAGTATGGTTCGAGCAAGTCTGA
Gene >Hirsu2|984
CTGCTGACGGCACGGCGGCCGACGACGCGCCCGCCGCCGAGGCCCGCCCGCCTTTCCTTCCTCGAGCCGCGGCGG
TGGCGGGCCGAGGTCGACGCCCTGCGCCGCCGACAGACGTACTGCCGGCCGACGCTCGAGTTCGCATCGCCGCGC
GTGGCCCCGGCCGTGGACGGCCTGCTCGACCTGATACTGCGCGACTTCGTGCGCTCCTGGTACTCGCACATCAGC
CGAAACCCCGTCTTCCCGAACGAGGTCGATCGAGCGGTCCGCCTGGCCCTGTCCAGCCTCGTCCGGCCGCTCCGC
GAGAGGGACCTGGCCGACGTGGTCACGAGCCGGCTGGTGCCCATCCTCACCACGCACTTCCGCGACTTCTACGAC
GCCGAGCGGTCGGTCCGCGGCCGCAAGCTCAACCGGTCCGTCACCGAGTCGGAGGAGCTGGACCTGGCCATCGCC
TCCAAATACCGCGACGGCCGGCTGCACCCGGCCGCCTCGCTCACCTTCCCCGACACCAAGATGGTCCAGCAGGAG
TACCTGCGGTCCCTGGTCGCCCGCATCATGCCGAGCGTGCTGCCGGAGCGGATGCTCTCGAGCCGGGCCGTCTTC
GCCCTCGTGCGCGAGATGGTCGCCTGCGCCCTCCTCTTCCCCGTCGTCCAGCTGCTGTCCGACCCGGACACGTGG
AACCAGCTGATGGAGAGCTACGGCCGCTCCATGCTGCAGGACCGCTCCACCGTCCGCCGGCTCCGCGCCGCCCTC
GACCAGCACGCCCAGCCCGTGCCGGCCCGGTCGGCCAAGTCGGCCGCCGCGCCGCCGCGCATCGCCCCGGGCGAC
AGCGAGCGCAAGTTCGAAAAGTTCATCCGCGCCATCCGCAAGGTCAACAACGTGTCGGACGCCCGCCGCTTCCGG
AGCGAGGTCAGCAGCCAGCTCAAGCGCGACTCGCTCGAGGACCAGCAGGACCCGGTCTACCTGCGCCGCCTGGAG
ATGGGCAAGAGGCTGCTCGACCAGCGCGTCGGCCAGCTCGCCGCCCCCAGCGACCACCGCGCCCCGGCCTCCCGC
CCGCCCCGGCCCCCGCCGCCCAACCCCGGTGCCGCCTCGCGCCTCCAGGACGCGTCCCTGGTCGAGCTGCTCCGG
GACTCGTCCGGGCTGTCGTACTTCATGGAGTACATGGACCGCCAGCACGCCATGTCGCTCGTCCAGTTCTGGCTC
GTCGTCGACGGCTTCCGAAACCCGCTCGAGGACGACGGGGCCGACGAGGACGAGGGCGACGACGGGGCCCCGTCC
AGCCTGCCCATGTGGAAGGACTCGGACCGGGTCGACCTGCAGCAGATCCACCAGGCCTACCTGTCCAAGCCCGAG
CTGAACGTGCCGGAATCGACCAAGAGCACGGTGCGCCGGTTCCTCAAGGCCGGCGCCGCCGCGACGCCCGCGCAG
TATCACAACGCCCGGCGATCCATCCTCAAGGCCCAGAGCGCCGTCCTCGAGGAGATGCAGGCCCGCTACTTCCAG
GCCTTCAAAAAGTCGGACCTGTACTACAAGTGCCTCGCGTCGCAAGAGGCGTCGAACGCCAGCATCCCGCCTACG
CCGGCCCCTTCGGGCCACGGAGGGCCACAACTACAACAACCACAACCACAACCACAATCAAACCATGCCCCCAAC
CATTCTCATCCGCCCGTGCAACGGGCAGCTCCTTCCTACCAGTCGAGGCCCAAACCCGTCGCCAGACTCACGACC
GCTCCACCCGAGGTCATGGCCGCCAGACGATGCGGCTCGGCCTCAGACTTGCGGGCATTGCACGAGAGCCACAAC
GGGGGGACAGACCCCCTGGTAGCCTCGCGGCGATCTCTGGATGAGGGCTCCGCCGGGCCCATCTTCAGCGACGAC
GACCTGGACCACGACGGCATGCTCGATTCGGTGCAGAGCCTGGACGCGTACGCGCCGGCGCGGCAGCCCCCGGAC
ACCCAGGTGGTGCAGGCCGTGGAGCAGGCCCTCAACAACATCATGGGCGACGACCGGCCGCAGACGGCCGAGGAC
CTGCGGGCCTCCCTTTTCGGGCCGGACGACGCCGACTCGGGCCTCTTCCTGGGACCCGAGAACGACTCGGGCCGC
GGGTCCATGGACGCCGGCCGCGCGCCCTCGGTCCTGAGCAAGGACGCGGAGAAGCCCAGCCTGTCGTCGCTGGGC
CTGGTCAGCGCCGCGTCGCGCATCGGCGTGTTCGTGGACGACGACCTGTTCGGAGACGACGACAACCACGTCCCG
GAGGAGTGCGAGGAGGGCGAAGACGGGACGGGCGCGGCCGAGGACGGGGACGAGGTGCACGAGGCCGCGCCCGGA
GACCTCGGGTTGGCCGAGGCCATCGCGGCCCTGGGCAGCGACATCGACCGCCTGGTGGCGCAGGAGGCCGTGGTG
GACTCGCTGACGAAGAAGGCGGAGCTCACGAACAACACGCCGGAGCTGCGGATCCTCCGCAAGTCCAAGGCCAGC
CTGCAGCGGGAGATACGGCGCAAGGAGCTCCAGCGGCAGCAGTACATCGTGCAGGAGAGCGACAACAGCCTGTAC
GGGCGCTCGGCCATCAGGATCAAGTCGATCCAGGTGGGCCGGGAGGAGGACGGGCGAGAGTTCGCGCTCTACGTG
GTCGAGGTGCAGCGCGACGCGGGGGAGCAGATGCCGGCGGCGTCGTGGATCGTCACGAGGCGGTACAGCGAGTTC
CACGACCTCCACCAGAAGCTGCGGACGGGGCACCCGTCGGTGAGGAACCTCGAGTTCCCGCGGCGGCGCATGGTG
ATGAAGTTCCAGAGCGAGTTCCTGCGCAAGAGGAGGACGGCGCTGGAGAAGTACCTGCGGGAACTTTTGCTGCTG
CCGGACGTGTGTCGCAGCCGCGAGCTGCGCGCGTTCCTGTCGCAGAGCATCATCGCGCAGGGCCAGGACCTGTCG
GACCGCGAGGACAAGAAGGACATGATGACGCGCCTGTACGACTCGGTCGCGGACGGCATGGACGACATCCTGGGC
AACATTCCCGTGCTGGACCAGATCTCGGTGGCGGGCCAGAACCTGATCGCGGCGGCGACGAGCCAGCTCAACGCG
ATGCCGCTCAACGTCGGCGAGGACGACGGCTTCCCGGCGGCCGAGGCCGAGGCGGAGCTCAACGCGTTCGAGGAC
AAGGAGCTCGAGCCCTTCATCAAGCCCATCTGCGACATCTTCCTCGAGGTCTTCGAGCTCAACAGGGGCAACAAC
TGGCTGCGCGGGAGGGCGGTCGTCATGGTGCTCCAGCAGCTGCTCGGCGGGACCATCGAGCGCAAGGTGCGCGAC
AACGTCAAGGTGCTGGTCCAGGAGGACTCGCTCCTGCGGTACGTCGGCATGGTCACGGACAGGCTGTGGCCGGAC
GGCGAGCTGCGGCGCGGCGAGCGCGAGGCCGCGGGGGCGCGGGGGCCGGCGGAGCGGAAGAAGACGCGAACGGAA
GCGAGCCTGATGCTTGCGACGCTGGTGCCGGACCTGGCCGGCAGCGTCGTCGGGCGCGTCAACGCGCAGGCCGCA
AGCCGGCGCATCTTTGCGACGTTTAACAACGCTCGACTCAAGTATGTGACGAATTCTCCTTGCCCCCCTCTTCTC
TCTCCTCTCCTCTCCTCTCCTCCTCTCCCCCTTCCGTCCTTCGCCCCTTCGAATAAAAAGGATAACAACCCCCCA
CCCCCCCTCCTCAAAACAATAGATTTCCGAATAAGGAAACAAAAAGAAAGGGGAAGAGAATGGAAGCGCAGAAAA
AGAAAGTTGGAGCGGACGGCGGCTAACGACGCGTGTTTTTGGCGTGTCTCGCAGTGCTCACCTCGTCTTCACCGT
CCTCGACGAGATTGTGTCAGTATGGTTCGAGCAAGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail