Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9839
Gene name
LocationContig_746:1021..3464
Strand-
Gene length (bp)2443
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 2.6E-06 145 367

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 8 260 8.0E-10
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 8 260 8.0E-10
sp|Q97BG8|DNAK_THEVO Chaperone protein DnaK OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaK PE=3 SV=1 146 425 4.0E-08
sp|Q7UM31|DNAK_RHOBA Chaperone protein DnaK OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=dnaK PE=3 SV=2 114 425 3.0E-06
sp|A0RPW7|DNAK_CAMFF Chaperone protein DnaK OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=dnaK PE=3 SV=1 7 410 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9839
MTATNPSIVIGIDFGTTYSGVSWAPAGSYIQTISGWPSGSGPNNDKRKTPSALVYRSEGQPPVWGYRIPYEDVAL
RWFKLLLLDDEDIPAHVRDSEYLKEARRQLKQNNRHAGEVIADYLRELWKQGLQSIEQSVGKRRVSTSRFELVVT
LPAIWPQYARKRMEAAVQSSGLLDYRKQGPTTLTFISEPEAAALATMEDFEGRVEFKKNDHFVVCDAGGGTVDII
SYKVIRERPLQLRESVKGDGKLCGSIVLDSRFLALAKTKTWDSPWDQLDGGGAHYIMQHHWENEFKKMSIEEGSF
EVTLPIRLPSAKRARPANYKLTFSRDEVRDVYEPVVNEISALVLDQAREVAKMSKKSPTSVVLVGGLGNSQVLYR
ALAKEIEAEFPLTELLQAQGDRPWTAVCRGAVLRGLARCGPSPDAQEHDVRDKAWCPVSREFLAVDQVKWFIYMG
ETLSVDSPVVHDFWQDLEEPGDCIETEIVYSTTGDRPSYRFDGTVQHLCTIRWSKIPPFSSLPVWTNAEGKEIRQ
VCYEVRMVPDGATLDFVIFYDGAMVASKNVDIDCTPRGASRLRRVALSGGRSTTPFSAKRAASRDRDG*
Coding >Hirsu2|9839
ATGACGGCCACCAACCCGTCGATCGTCATCGGCATCGACTTTGGCACGACCTACTCTGGGGTTTCTTGGGCACCC
GCCGGAAGCTATATCCAGACCATCTCGGGCTGGCCCTCGGGCTCTGGCCCGAACAACGACAAGCGGAAGACGCCG
AGCGCGCTGGTCTACCGGTCTGAAGGGCAGCCGCCCGTCTGGGGATACAGAATCCCCTACGAGGACGTCGCCTTG
CGCTGGTTCAAGCTGCTCCTGCTCGACGACGAGGACATCCCGGCTCACGTCAGGGACTCGGAGTATCTGAAGGAA
GCCAGGCGCCAGCTGAAGCAGAACAACCGACACGCGGGCGAGGTCATTGCCGACTACCTCCGTGAACTCTGGAAG
CAGGGCCTGCAGAGCATCGAGCAGTCGGTCGGGAAACGTCGGGTTTCGACCTCCCGATTCGAGTTGGTCGTCACG
CTGCCGGCCATCTGGCCTCAGTACGCCAGGAAGAGGATGGAAGCGGCCGTCCAGTCGTCTGGCCTCCTCGACTAC
CGAAAGCAGGGGCCAACGACGCTGACCTTCATCTCGGAGCCCGAGGCCGCAGCGCTGGCGACGATGGAGGACTTC
GAAGGACGGGTAGAGTTCAAGAAAAATGACCACTTCGTCGTCTGCGATGCAGGCGGCGGAACCGTGGACATTATC
TCGTACAAGGTCATACGAGAGCGCCCTCTCCAGCTGCGGGAGAGCGTCAAGGGAGATGGCAAGCTCTGCGGTTCC
ATCGTGCTCGACAGCCGCTTTCTCGCTCTCGCGAAGACCAAGACCTGGGACAGCCCTTGGGATCAGCTGGATGGA
GGCGGTGCTCATTACATCATGCAGCACCACTGGGAGAACGAGTTCAAGAAGATGAGCATTGAGGAGGGCAGCTTC
GAGGTGACGCTGCCGATTCGCCTGCCTTCCGCCAAAAGGGCTCGGCCCGCCAACTACAAACTCACCTTCAGCCGG
GACGAAGTTCGGGACGTTTACGAGCCCGTGGTGAATGAAATCAGTGCGCTCGTGCTGGACCAGGCGCGCGAAGTC
GCCAAGATGAGCAAGAAGAGCCCCACGTCGGTCGTCCTGGTCGGCGGCCTCGGCAACTCTCAGGTCCTGTACCGG
GCCCTCGCGAAAGAAATCGAGGCCGAGTTCCCCCTGACCGAGCTCCTCCAGGCGCAAGGAGACAGACCGTGGACG
GCCGTCTGCCGCGGCGCGGTGCTCCGGGGCTTGGCCCGGTGCGGGCCGAGCCCGGATGCGCAGGAGCACGACGTC
CGCGACAAGGCATGGTGCCCCGTGAGCCGCGAGTTCCTGGCCGTCGACCAGGTCAAGTGGTTCATCTACATGGGC
GAGACGCTTTCGGTCGACAGCCCCGTCGTCCACGACTTCTGGCAGGACCTCGAGGAGCCGGGCGACTGCATCGAG
ACGGAGATTGTCTACTCGACGACCGGGGACCGGCCGTCGTACCGCTTCGACGGCACGGTCCAGCACCTGTGCACG
ATCCGCTGGTCCAAGATCCCGCCCTTCAGCAGCCTCCCGGTCTGGACCAACGCCGAGGGCAAGGAGATCCGGCAG
GTATGCTACGAGGTTAGGATGGTGCCGGACGGAGCCACGCTGGACTTCGTCATCTTCTACGACGGGGCCATGGTC
GCGTCCAAGAACGTGGACATCGACTGCACTCCCCGCGGGGCCAGCCGTCTTCGTCGCGTCGCCCTGTCCGGCGGA
CGGAGCACGACGCCCTTCTCGGCAAAGCGCGCAGCGAGCCGGGATCGTGATGGATGA
Transcript >Hirsu2|9839
ATGACGGCCACCAACCCGTCGATCGTCATCGGCATCGACTTTGGCACGACCTACTCTGGGGTTTCTTGGGCACCC
GCCGGAAGCTATATCCAGACCATCTCGGGCTGGCCCTCGGGCTCTGGCCCGAACAACGACAAGCGGAAGACGCCG
AGCGCGCTGGTCTACCGGTCTGAAGGGCAGCCGCCCGTCTGGGGATACAGAATCCCCTACGAGGACGTCGCCTTG
CGCTGGTTCAAGCTGCTCCTGCTCGACGACGAGGACATCCCGGCTCACGTCAGGGACTCGGAGTATCTGAAGGAA
GCCAGGCGCCAGCTGAAGCAGAACAACCGACACGCGGGCGAGGTCATTGCCGACTACCTCCGTGAACTCTGGAAG
CAGGGCCTGCAGAGCATCGAGCAGTCGGTCGGGAAACGTCGGGTTTCGACCTCCCGATTCGAGTTGGTCGTCACG
CTGCCGGCCATCTGGCCTCAGTACGCCAGGAAGAGGATGGAAGCGGCCGTCCAGTCGTCTGGCCTCCTCGACTAC
CGAAAGCAGGGGCCAACGACGCTGACCTTCATCTCGGAGCCCGAGGCCGCAGCGCTGGCGACGATGGAGGACTTC
GAAGGACGGGTAGAGTTCAAGAAAAATGACCACTTCGTCGTCTGCGATGCAGGCGGCGGAACCGTGGACATTATC
TCGTACAAGGTCATACGAGAGCGCCCTCTCCAGCTGCGGGAGAGCGTCAAGGGAGATGGCAAGCTCTGCGGTTCC
ATCGTGCTCGACAGCCGCTTTCTCGCTCTCGCGAAGACCAAGACCTGGGACAGCCCTTGGGATCAGCTGGATGGA
GGCGGTGCTCATTACATCATGCAGCACCACTGGGAGAACGAGTTCAAGAAGATGAGCATTGAGGAGGGCAGCTTC
GAGGTGACGCTGCCGATTCGCCTGCCTTCCGCCAAAAGGGCTCGGCCCGCCAACTACAAACTCACCTTCAGCCGG
GACGAAGTTCGGGACGTTTACGAGCCCGTGGTGAATGAAATCAGTGCGCTCGTGCTGGACCAGGCGCGCGAAGTC
GCCAAGATGAGCAAGAAGAGCCCCACGTCGGTCGTCCTGGTCGGCGGCCTCGGCAACTCTCAGGTCCTGTACCGG
GCCCTCGCGAAAGAAATCGAGGCCGAGTTCCCCCTGACCGAGCTCCTCCAGGCGCAAGGAGACAGACCGTGGACG
GCCGTCTGCCGCGGCGCGGTGCTCCGGGGCTTGGCCCGGTGCGGGCCGAGCCCGGATGCGCAGGAGCACGACGTC
CGCGACAAGGCATGGTGCCCCGTGAGCCGCGAGTTCCTGGCCGTCGACCAGGTCAAGTGGTTCATCTACATGGGC
GAGACGCTTTCGGTCGACAGCCCCGTCGTCCACGACTTCTGGCAGGACCTCGAGGAGCCGGGCGACTGCATCGAG
ACGGAGATTGTCTACTCGACGACCGGGGACCGGCCGTCGTACCGCTTCGACGGCACGGTCCAGCACCTGTGCACG
ATCCGCTGGTCCAAGATCCCGCCCTTCAGCAGCCTCCCGGTCTGGACCAACGCCGAGGGCAAGGAGATCCGGCAG
GTATGCTACGAGGTTAGGATGGTGCCGGACGGAGCCACGCTGGACTTCGTCATCTTCTACGACGGGGCCATGGTC
GCGTCCAAGAACGTGGACATCGACTGCACTCCCCGCGGGGCCAGCCGTCTTCGTCGCGTCGCCCTGTCCGGCGGA
CGGAGCACGACGCCCTTCTCGGCAAAGCGCGCAGCGAGCCGGGATCGTGATGGATGA
Gene >Hirsu2|9839
ATGACGGCCACCAACCCGTCGATCGTCATCGGCATCGACTTTGGCACGACGTACGTTTCTCCAGACTGATCTCCA
GAAACTTTGAATGAACGCCGAGTGCTGCCAGCTGACTTGTTTTCGTAGCTACTCTGGGGTTTCTTGGGCACCCGC
CGGAAGCTATATCCAGACCATCTCGGGCTGGCCCTCGGGCTCTGGCCCGAACAACGACAAGCGGAAGACGCCGAG
CGCGCTGGTCTACCGGTCTGAAGGGCAGCCGCCCGTCTGGGGATACAGAATCCCCTACGAGGACGTCGCCTTGCG
CTGGTTCAAGCTGCTCCTGCTCGACGACGAGGACATCCCGGCTCACGTCAGGGACTCGGAGTATCTGAAGGAAGC
CAGGCGCCAGCTGAAGCAGAACAACCGACACGCGGGCGAGGTCATTGCCGACTACCTCCGTGAACTCTGGAAGCA
GGGCCTGCAGAGCATCGAGCAGTCGGTCGGGAAACGTCGGGTTTCGACCTCCCGATTCGAGTTGGTCGTCACGCT
GCCGGCCATCTGGCCTCAGTACGCCAGGAAGAGGATGGAAGCGGCCGTCCAGTCGTCTGGCCTCCTCGACTACCG
AAAGCAGGGGCCAACGACGCTGACCTTCATCTCGGAGCCCGAGGCCGCAGCGCTGGCGACGATGGAGGACTTCGA
AGGACGGGTAGAGTTCAAGGCATGTCATGGCTTTCCCCCCTCCCCATTCACCACTACGCCCCAGAGCTTGGCTGA
CGATGATCGAACGGTAGAAAAATGACCACTTCGTCGTCTGCGATGCAGGCGGCGGAACCGTGGTAAGTTGCCGGC
TCATCCTCTCCTCCTCTCCCCTTTATCTGTCTGCCTTCTTCTCATCACGTTCAGGACATTATCTCGTACAAGGTC
ATACGAGAGCGCCCTCTCCAGCTGCGGGAGAGCGTCAAGGGAGATGGTAAGTGCAGAGTGCACCAATGCCATATC
CGTAACGTCATCTTCATATTGACTCGGCTGTCCTTTTTCCAGGCAAGCTCTGCGGTTCCATCGTGCTCGACAGCC
GCTTTCTCGCTCTCGCGAAGACCAAGACCTGGGACAGCCCTTGGGATCAGCTGGATGGAGGCGGTGCTCATTACA
TCATGCAGCACCACTGGGAGAACGAGTTCAAGAAGATGAGCATTGAGGAGGGCAGCTTCGAGGTGACGCTGCCGA
TTCGCCTGCCTTCCGCCAAAAGGGCTCGGCCCGCCAACTACAAACTCACCTTCAGCCGGTACGTGCCATATTCAC
TGACGATTATATCCATGCCCAGCTCGGAAGAGACCAGCCAGCACGTTCAAATCGGCTGACAACTGGCAGGGACGA
AGTTCGGGACGTTTACGAGCCCGTGGTGAATGAAATCAGTGCGCTCGTGCTGGACCAGGCGCGCGAAGTCGCCAA
GATGAGCAAGAAGAGCCCCACGGTACGTTCCGTGGCAAGCCGAGATGGTCCCCGTTGAATCGTTCCGTGTCTGAC
CGTGTCGGTAGTCGGTCGTCCTGGTCGGCGGCCTCGGCAACTCTCAGGTCCTGTACCGGGCCCTCGCGAAAGAAA
TCGAGGCCGAGTTCCCCCTGACCGAGCTCCTCCAGGCGCAAGGAGACAGACCGTAAGTCTCGATCCCGTTCTCGC
CTCTCGAGTACAGAAATGGCCGGCATTCTGACGCGGCTTCCCCGCAGGTGGACGGCCGTCTGCCGCGGCGCGGTG
CTCCGGGGCTTGGCCCGGTGCGGGCCGAGCCCGGTGACGACGGTGGACGCGCGGGTGGCCCGAGCGAGCTTCGGC
ACGACGTTCAATGTTCTTCCATAGGATGCGCAGGAGCACGACGTCCGCGACAAGGCATGGTGCCCCGTGAGCCGC
GAGTTCCTGGCCGTCGACCAGGTCAAGTGGTTCATCTACATGGTGAGTGCGGCGAAAGCAAACCCCCCCGGGTCC
CGCCACGGCATCGCCGCCGCAGCCGCAACACGTCCGCTGACGGAGCTTCGGAAACCAGGGCGAGACGCTTTCGGT
CGACAGCCCCGTCGTCCACGACTTCTGGCAGGACCTCGAGGAGCCGGGCGACTGCATCGAGACGGAGATTGTCTA
CTCGACGACCGGGGACCGGCCGTCGTACCGCTTCGACGGCACGGTCCAGCACCTGTGCACGATCCGCTGGTCCAA
GATCCCGCCCTTCAGCAGCCTCCCGGTCTGGACCAACGCCGAGGGCAAGGAGATCCGGCAGGTATGCTACGAGGT
TAGGATGGTGCCGGACGGAGCCACGCTGGACTTCGTCATCTTCTACGACGGGGCCATGGTCGCGTCCAAGAACGT
GGACATCGACTGCACTCCCCGCGGGGCCAGCCGTCTTCGTCGCGTCGCCCTGTCCGGCGGACGGAGCACGACGCC
CTTCTCGGCAAAGCGCGCAGCGAGCCGGGATCGTGATGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail