Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9838
Gene name
LocationContig_746:47..669
Strand+
Gene length (bp)622
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5128 0.6116 0.0914 0.0807 0.1542 0.0152 0.1482 0.028 0.3112 0.0151

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4668
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|1688
Ophiocordyceps camponoti-floridani Ophcf2|00387
Ophiocordyceps camponoti-rufipedis Ophun1|7338
Ophiocordyceps kimflemingae Ophio5|4901
Ophiocordyceps subramaniannii Hirsu2|9838 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9838
MQEKESKRDDGTAAPVRSSKKKTRKAQAAAAAAQDSSSGPVPSGVRKRVVAENGKILVVDSQGDVFLEGEDEDGN
VHEFLLDPDELHQPTFKDTAVVRVPMWFLEVGLGRFRSAHAADNESDDAGDDSDAPQPTPSTDSAGDDFEMLDKS
TDSLAKVKATGTQQGGGGGKANKRRGKKR*
Coding >Hirsu2|9838
ATGCAGGAGAAGGAGTCCAAGCGCGACGACGGCACCGCCGCCCCGGTCCGCAGCAGCAAGAAGAAGACCCGCAAG
GCTCAGGCCGCCGCCGCCGCCGCGCAGGACTCGTCCTCCGGCCCCGTCCCCTCGGGCGTGCGCAAGAGGGTCGTG
GCCGAGAACGGCAAGATCCTCGTCGTCGACTCCCAGGGCGACGTCTTCCTCGAGGGCGAGGACGAGGACGGCAAC
GTGCACGAGTTTCTCCTCGACCCCGACGAGCTCCACCAGCCGACCTTCAAGGACACCGCCGTCGTCCGGGTCCCC
ATGTGGTTCCTCGAGGTCGGCCTCGGCCGCTTCCGATCCGCCCATGCCGCCGACAACGAGTCGGACGACGCTGGC
GACGACTCGGACGCCCCGCAGCCCACCCCGAGCACCGACTCGGCCGGCGACGACTTCGAGATGCTCGACAAGAGC
ACCGACTCCCTCGCCAAGGTCAAGGCCACCGGCACCCAGCAGGGCGGCGGCGGCGGCAAGGCCAACAAGCGGAGG
GGCAAGAAGCGGTAG
Transcript >Hirsu2|9838
ATGCAGGAGAAGGAGTCCAAGCGCGACGACGGCACCGCCGCCCCGGTCCGCAGCAGCAAGAAGAAGACCCGCAAG
GCTCAGGCCGCCGCCGCCGCCGCGCAGGACTCGTCCTCCGGCCCCGTCCCCTCGGGCGTGCGCAAGAGGGTCGTG
GCCGAGAACGGCAAGATCCTCGTCGTCGACTCCCAGGGCGACGTCTTCCTCGAGGGCGAGGACGAGGACGGCAAC
GTGCACGAGTTTCTCCTCGACCCCGACGAGCTCCACCAGCCGACCTTCAAGGACACCGCCGTCGTCCGGGTCCCC
ATGTGGTTCCTCGAGGTCGGCCTCGGCCGCTTCCGATCCGCCCATGCCGCCGACAACGAGTCGGACGACGCTGGC
GACGACTCGGACGCCCCGCAGCCCACCCCGAGCACCGACTCGGCCGGCGACGACTTCGAGATGCTCGACAAGAGC
ACCGACTCCCTCGCCAAGGTCAAGGCCACCGGCACCCAGCAGGGCGGCGGCGGCGGCAAGGCCAACAAGCGGAGG
GGCAAGAAGCGGTAG
Gene >Hirsu2|9838
ATGCAGGAGAAGGAGTCCAAGCGCGACGACGGCACCGCCGCCCCGGTCCGCAGCAGCAAGAAGAAGACCCGCAAG
GCTCAGGCCGCCGCCGCCGCCGCGCAGGACTCGTCCTCCGGCCCCGTCCCCTCGGGCGTGCGCAAGAGGGTCGTG
GCCGAGAACGGCAAGATCCTCGTCGTCGACTCCCAGGGCGACGTCTTCCTCGAGGGCGAGGACGAGGACGGCAAC
GTGCACGAGTTTCTCCTCGACGTGAGTTCTCCCCCCCTTTCCTCCCCTGGCCGGTAAAGTCGGCGCGGAACCAAC
CGGCCCCCTTACTGACCGGCTCGCGCAGCCCGACGAGCTCCACCAGCCGACCTTCAAGGACACCGCCGTCGTCCG
GGTCCCCATGTGGTTCCTCGAGGTCGGCCTCGGCCGCTTCCGATCCGCCCATGCCGCCGACAACGAGTCGGACGA
CGCTGGCGACGACTCGGACGCCCCGCAGCCCACCCCGAGCACCGACTCGGCCGGCGACGACTTCGAGATGCTCGA
CAAGAGCACCGACTCCCTCGCCAAGGTCAAGGCCACCGGCACCCAGCAGGGCGGCGGCGGCGGCAAGGCCAACAA
GCGGAGGGGCAAGAAGCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail