Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9831
Gene name
LocationContig_744:5170..9487
Strand-
Gene length (bp)4317
Transcript length (bp)4263
Coding sequence length (bp)4263
Protein length (aa) 1421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00940 RNA_pol DNA-dependent RNA polymerase 1.9E-181 817 1420
PF14700 RPOL_N DNA-directed RNA polymerase N-terminal 2.3E-93 358 693

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P13433|RPOM_YEAST DNA-directed RNA polymerase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO41 PE=1 SV=2 133 1316 0.0E+00
sp|O13993|RPOM_SCHPO DNA-directed RNA polymerase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpo41 PE=3 SV=2 359 1252 0.0E+00
sp|P38671|RPOM_NEUCR DNA-directed RNA polymerase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-5 PE=3 SV=2 27 1420 0.0E+00
sp|Q9LFV6|RPOT2_ARATH DNA-directed RNA polymerase 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RPOT2 PE=1 SV=1 406 1245 4.0E-153
sp|O24600|RPOT3_ARATH DNA-directed RNA polymerase 3, chloroplastic OS=Arabidopsis thaliana GN=RPOT3 PE=2 SV=1 341 1245 2.0E-151
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P13433|RPOM_YEAST DNA-directed RNA polymerase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO41 PE=1 SV=2 133 1316 0.0E+00
sp|O13993|RPOM_SCHPO DNA-directed RNA polymerase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpo41 PE=3 SV=2 359 1252 0.0E+00
sp|P38671|RPOM_NEUCR DNA-directed RNA polymerase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-5 PE=3 SV=2 27 1420 0.0E+00
sp|Q9LFV6|RPOT2_ARATH DNA-directed RNA polymerase 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RPOT2 PE=1 SV=1 406 1245 4.0E-153
sp|O24600|RPOT3_ARATH DNA-directed RNA polymerase 3, chloroplastic OS=Arabidopsis thaliana GN=RPOT3 PE=2 SV=1 341 1245 2.0E-151
sp|P92969|RPOT1_ARATH DNA-directed RNA polymerase 1, mitochondrial OS=Arabidopsis thaliana GN=RPOT1 PE=2 SV=1 402 1245 4.0E-150
sp|Q8L6J3|RPO2B_TOBAC DNA-directed RNA polymerase 2B, chloroplastic/mitochondrial OS=Nicotiana tabacum GN=RPOT2-TOM PE=2 SV=2 549 1253 9.0E-149
sp|Q8VWF8|RPOT2_NICSY DNA-directed RNA polymerase 2, chloroplastic/mitochondrial OS=Nicotiana sylvestris GN=RPOT2 PE=2 SV=2 549 1253 2.0E-148
sp|Q93Y94|RPOT1_NICSY DNA-directed RNA polymerase 1, mitochondrial OS=Nicotiana sylvestris GN=RPOT1 PE=2 SV=1 537 1245 9.0E-147
sp|Q8L6J5|RPO1B_TOBAC DNA-directed RNA polymerase 1B, mitochondrial OS=Nicotiana tabacum GN=RPOT1-TOM PE=2 SV=2 537 1245 1.0E-146
sp|P69242|RPOT3_NICSY DNA-directed RNA polymerase 3, chloroplastic OS=Nicotiana sylvestris GN=RPOT3 PE=2 SV=1 547 1248 2.0E-145
sp|P69243|RPO3A_TOBAC DNA-directed RNA polymerase 3A, chloroplastic OS=Nicotiana tabacum GN=RPOT3-SYL PE=3 SV=1 547 1248 2.0E-145
sp|Q8L6J1|RPO3B_TOBAC DNA-directed RNA polymerase 3B, chloroplastic OS=Nicotiana tabacum GN=RPOT3-TOM PE=2 SV=2 547 1248 2.0E-142
sp|O00411|RPOM_HUMAN DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens GN=POLRMT PE=1 SV=2 554 1241 2.0E-131
sp|Q8BKF1|RPOM_MOUSE DNA-directed RNA polymerase, mitochondrial OS=Mus musculus GN=Polrmt PE=1 SV=1 547 1247 3.0E-124
sp|Q8L6J2|RPO2A_TOBAC DNA-directed RNA polymerase 2A (Fragment) OS=Nicotiana tabacum GN=RPOT2-SYL PE=3 SV=1 875 1253 2.0E-77
sp|P18147|RPOL_BPK11 DNA-directed RNA polymerase OS=Enterobacteria phage K11 GN=1 PE=3 SV=1 537 1244 6.0E-72
sp|P07659|RPOL_BPT3 DNA-directed RNA polymerase OS=Enterobacteria phage T3 GN=1 PE=3 SV=1 554 1266 4.0E-67
sp|P00573|RPOL_BPT7 T7 RNA polymerase OS=Enterobacteria phage T7 GN=1 PE=1 SV=2 554 1244 1.0E-63
sp|Q7Y2D9|RPOL_BPKMV DNA-directed RNA polymerase OS=Enterobacteria phage phiKMV GN=gp26 PE=3 SV=1 636 1260 1.0E-62
sp|P06221|RPOL_BPSP6 DNA-directed RNA polymerase OS=Enterobacteria phage SP6 PE=2 SV=1 540 1247 1.0E-56
sp|P33540|RPOP_NEUCS Probable DNA-directed RNA polymerase OS=Neurospora crassa PE=3 SV=1 756 1234 2.0E-40
sp|P22372|RPOP_CLAPU Probable DNA-directed RNA polymerase OS=Claviceps purpurea PE=3 SV=1 548 1235 1.0E-35
sp|Q8L6J4|RPO1A_TOBAC DNA-directed RNA polymerase 1A (Fragment) OS=Nicotiana tabacum GN=RPOT1-SYL PE=3 SV=2 1127 1245 2.0E-32
sp|P33539|RPOP_AGABT Probable DNA-directed RNA polymerase OS=Agaricus bitorquis PE=3 SV=1 633 1235 2.0E-31
sp|P33541|RPOP_NEUIN Probable DNA-directed RNA polymerase OS=Neurospora intermedia PE=3 SV=2 632 1282 1.0E-30
sp|Q01521|RPOP_PODAS Probable DNA-directed RNA polymerase OS=Podospora anserina PE=3 SV=1 632 1012 7.0E-28
sp|O03685|RPOP_GELSP Probable DNA-directed RNA polymerase OS=Gelasinospora sp. (strain G114) PE=3 SV=1 767 1244 3.0E-26
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0097747 RNA polymerase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9831
MFTRQTGSGLLVHRGLAARSAGPSLRRPVLRSCAVSLGRRLGASLPPRPSPRPEPEGGRGRALQGRGLATAVDDF
GIQTSPYDRLKSSTSPSSQGPLKLSHMRPFDAASPLTIPEPPPPKPMSRMNIYGIPGDIDDLIPILQACLQVGKL
DRAALLIQRLELVGASAEQRILFCNQYLRVSLEQMHSKPAKKQAEKLHSWYQLQVLDKRLPHTAETIACMLKASL
MTERGPRLQRLVDRYMGMAPGEAGLRVLGMAHILTDSDLAALTKLCPTYNYAEETAEPSAALEPQHQESDDVAQM
PLDSTAAEAAVRADDAPEVLPTPQRGQGLAALRQGLSIFSELQNIDISKLPPEEQKDIQQHLEHNTISVAVEKWR
RDRKTMQKAGITPAFGVSSAQSTLSHYMASWMAAMEDRINKELDLVAVAEERETKTALDLERCLYGPILRMSDPS
RLAALTILSVINLGAMNGIGKGFAVSRLVSNLARQLQEDIELQRRDEIKKSKRRGKIELADPNPASDSSHPSVSD
LISASASTGEDEIKIIEPAATEDDAPKFWTPTMQVHIGSALLRLLIETAKIPVTATHPVTGEPVSQDQPAFTHMM
QPRRGKRVGVVFVNNHLAQHLQREPMGDFIAKHLPMVAEPKPWKSFNEGGYLVSRTSLMRVKSGDIEQSLYIKAA
IQRGSMDKVFQSLDVLGKTAWRINRQTLDVMMEAWNSGEEIANMPKLNPEFELPPEPDSSADPLQRFQWLLAVKA
IENQRTSLHSQRCFMNLQLEIARAYRNQTIYFPHNVDYRGRAYPVPTYLNHMGADHTRALLMFAEGKKLGVSGLR
WLKIHLANVYGLDKASFNEREAFADENVDNIVDSATNPFKGSRWWLDAEDPWQCLTACFELKAALELAEPTEFVS
HLPIHQDGTCNGLQHYAALGGDTLGAKQVNLEPGDRPADVYSAVAELVKQAIDKDFEAGKDLFKEAAVEKDGDQD
VTRPDPNSPANYARILRGKITRKVVKQTVMTNVYGVTFTGAKKQVCKQLDALYPNLGKENGISNLTLACYIARHI
FNALASMFRGAHDIQYWLGEVGGRICRALTPSQLKQIEDLYAASQEPDDEEFEAPKKAKKNKKTIDAELAQQFRS
TVVWTTPLQMPVVQPYRDTNMKEVRTCLQAVVFPIHDQSNPVNRRKQLQAFPPNFIHSLDASHMMLSALECHDLG
LTFAAVHDSFWTHASDVDTMNTVLRDAFIQIHEEDVVGRLAVEFETRHRGSLYLTRIDSSSPVAKRIKEFRKTSG
KSMMEELLMEHRRNTLRLSGEPGDLKKAAEIVTPASLYEEMEASEVDVSIQEDTKAMGIGEIYDYSELATPSHQV
LDDDDGPRNEATPAPASDASKKAEDASQKTPRKSTTKATTPFWRPLTVPPVPKKGEFDVTRLRNSQYFFS*
Coding >Hirsu2|9831
ATGTTTACCCGACAGACGGGCAGCGGCCTGCTGGTCCATCGAGGACTGGCAGCGAGGTCGGCCGGGCCTTCGCTG
AGGCGACCGGTCCTGCGATCCTGCGCCGTCTCGCTTGGTCGCCGTCTGGGCGCCTCCCTCCCGCCTCGGCCCTCA
CCGCGGCCTGAGCCTGAGGGTGGACGCGGCCGCGCGCTGCAGGGCAGAGGCCTGGCCACGGCCGTCGACGACTTC
GGCATCCAGACGTCGCCCTACGATCGCTTGAAAAGCTCGACATCGCCATCCTCTCAGGGGCCTCTCAAACTGTCC
CACATGCGACCCTTCGATGCCGCATCGCCACTGACCATCCCCGAGCCCCCCCCGCCGAAGCCCATGTCCAGGATG
AACATCTATGGGATCCCCGGCGACATCGACGACCTCATTCCCATTCTTCAAGCATGCCTGCAGGTGGGCAAGCTG
GACCGAGCGGCCCTCTTGATCCAGCGCCTCGAGCTTGTCGGAGCCAGTGCCGAGCAAAGGATCCTGTTCTGTAAC
CAGTATCTCCGCGTATCTCTGGAACAGATGCACTCGAAGCCCGCCAAGAAGCAGGCTGAAAAGCTGCACAGCTGG
TACCAGCTGCAAGTCCTGGACAAGAGACTGCCCCACACGGCCGAGACCATCGCTTGCATGCTCAAGGCCTCCCTC
ATGACGGAGCGAGGGCCGAGGCTCCAGCGCCTCGTCGACCGCTACATGGGCATGGCCCCCGGCGAGGCCGGCCTG
CGCGTCCTCGGCATGGCCCATATCCTCACCGATAGCGATCTTGCCGCCCTCACCAAACTCTGCCCCACGTACAAC
TACGCCGAGGAGACGGCTGAGCCCTCGGCCGCTCTCGAACCGCAGCATCAAGAGTCAGACGACGTCGCCCAAATG
CCACTCGATAGCACAGCGGCAGAGGCCGCCGTCAGGGCCGACGATGCGCCGGAGGTTCTGCCGACCCCACAGCGT
GGCCAAGGACTGGCGGCGCTGAGGCAAGGCCTGTCCATCTTCTCCGAGCTGCAAAACATCGACATATCCAAACTG
CCCCCTGAAGAGCAGAAGGATATTCAGCAACACTTGGAACACAACACCATCAGCGTCGCCGTTGAGAAATGGCGA
CGGGACCGCAAGACCATGCAAAAGGCCGGCATCACCCCGGCTTTCGGAGTGTCGAGCGCGCAGAGCACACTTTCG
CATTACATGGCTTCTTGGATGGCCGCCATGGAAGATCGCATCAACAAGGAGCTGGACTTGGTCGCGGTAGCGGAA
GAAAGAGAAACGAAAACAGCGCTGGATTTAGAACGCTGTCTGTATGGCCCGATACTCCGAATGTCCGACCCGTCT
CGGCTCGCCGCCCTGACCATCTTGTCCGTAATCAATCTTGGTGCCATGAATGGCATTGGGAAGGGCTTTGCAGTA
AGCCGGCTCGTCTCAAATCTTGCTAGGCAACTGCAGGAAGACATCGAGCTCCAGCGCCGAGATGAGATCAAGAAG
TCCAAGCGGCGCGGCAAGATCGAGCTCGCAGACCCGAATCCGGCTTCCGATTCCTCTCACCCCTCCGTCTCCGAC
CTCATCTCTGCCTCCGCTTCGACTGGCGAGGACGAGATAAAGATCATCGAACCAGCCGCCACAGAGGACGACGCC
CCGAAATTCTGGACGCCAACCATGCAGGTTCACATCGGCTCCGCCCTTCTCAGGCTGCTGATCGAAACGGCCAAG
ATTCCAGTCACTGCGACGCACCCAGTCACCGGCGAGCCTGTAAGCCAAGACCAGCCGGCTTTTACGCACATGATG
CAACCTCGCAGGGGCAAACGGGTCGGCGTCGTTTTCGTCAACAACCATCTGGCGCAGCATCTTCAGCGAGAGCCC
ATGGGCGACTTCATTGCCAAGCACTTGCCCATGGTTGCGGAGCCCAAGCCCTGGAAGAGTTTCAACGAAGGCGGC
TACTTGGTCAGTAGGACGAGCCTGATGAGAGTGAAATCCGGCGATATCGAACAGAGCCTGTACATCAAAGCGGCC
ATCCAGCGCGGAAGCATGGACAAGGTTTTCCAATCACTGGATGTGCTCGGCAAGACGGCCTGGCGGATAAACAGA
CAGACGCTCGACGTCATGATGGAAGCCTGGAACTCGGGCGAGGAAATAGCCAACATGCCAAAGCTCAACCCCGAG
TTCGAGTTGCCGCCCGAGCCAGACTCGTCGGCCGACCCGCTTCAGCGATTTCAGTGGCTCCTTGCGGTCAAGGCC
ATTGAGAACCAAAGGACGAGTCTGCATTCCCAGCGCTGCTTCATGAACCTCCAGCTAGAAATTGCGCGGGCCTAC
CGGAACCAGACAATCTACTTCCCGCACAACGTGGACTACAGAGGCCGCGCCTACCCGGTCCCGACCTACCTGAAC
CACATGGGTGCCGACCACACCCGTGCCCTCTTGATGTTCGCCGAGGGAAAGAAGCTGGGTGTCAGCGGTCTGAGG
TGGTTGAAGATTCACCTGGCCAACGTGTATGGTCTCGATAAAGCGAGCTTCAACGAGCGAGAGGCCTTCGCCGAC
GAGAACGTCGACAACATTGTCGACTCGGCCACGAACCCCTTCAAGGGGAGCCGCTGGTGGTTGGACGCCGAGGAC
CCGTGGCAATGCCTGACCGCCTGCTTCGAGCTCAAGGCAGCTCTGGAGCTTGCTGAGCCCACCGAGTTCGTCTCC
CATCTGCCCATCCACCAAGACGGCACCTGCAACGGCCTCCAGCACTACGCAGCCCTGGGCGGCGACACCCTGGGC
GCGAAGCAGGTCAACCTGGAGCCCGGCGATCGTCCGGCCGATGTTTACTCGGCCGTCGCGGAACTTGTGAAGCAG
GCGATCGATAAGGATTTCGAGGCGGGCAAGGATCTGTTCAAGGAAGCCGCAGTTGAGAAGGATGGCGACCAAGAT
GTCACGCGCCCAGATCCGAACTCACCCGCCAACTACGCCAGGATCCTACGAGGCAAGATCACGCGCAAGGTCGTC
AAGCAGACCGTCATGACGAATGTGTACGGTGTCACGTTTACGGGGGCCAAGAAGCAGGTCTGCAAGCAGCTCGAC
GCCCTGTACCCCAACTTGGGCAAGGAGAACGGTATCAGCAACCTGACCCTGGCGTGTTACATCGCGAGGCACATC
TTCAACGCCCTGGCATCCATGTTTCGAGGCGCCCACGACATCCAGTACTGGCTGGGTGAAGTCGGCGGCCGGATC
TGCAGGGCGTTGACGCCCTCTCAGCTGAAACAAATCGAGGACTTGTACGCGGCGAGTCAAGAGCCGGACGACGAG
GAATTCGAGGCCCCGAAGAAGGCCAAGAAGAACAAGAAGACGATCGACGCCGAGCTGGCGCAGCAATTCCGATCC
ACGGTCGTCTGGACCACGCCGCTGCAGATGCCGGTGGTGCAGCCGTATCGCGACACCAACATGAAGGAGGTCAGG
ACCTGCCTGCAGGCGGTCGTCTTCCCCATTCACGACCAGTCGAACCCGGTGAATCGCAGGAAGCAGCTGCAGGCA
TTCCCGCCCAACTTCATCCACTCCCTGGACGCGAGCCACATGATGCTGTCGGCCCTGGAGTGCCACGACCTCGGG
CTCACCTTCGCGGCCGTCCACGACTCGTTCTGGACGCACGCCAGCGACGTCGACACGATGAACACGGTGCTGCGG
GACGCCTTTATCCAGATACACGAGGAGGACGTCGTCGGCCGCCTGGCCGTGGAATTCGAGACGCGGCACAGGGGC
TCGCTGTACCTGACGCGCATCGACTCGTCGAGCCCGGTGGCGAAGAGGATCAAGGAATTTCGCAAGACCAGCGGA
AAGTCGATGATGGAAGAGCTTCTCATGGAGCACAGGCGGAACACGCTTCGGCTGTCCGGCGAGCCGGGGGATCTC
AAGAAGGCTGCCGAGATCGTCACGCCCGCCTCGCTGTACGAGGAGATGGAGGCGTCCGAGGTGGACGTCTCCATC
CAGGAGGACACCAAGGCCATGGGCATCGGAGAAATCTACGACTACTCGGAGCTGGCGACGCCCAGCCACCAGGTG
CTGGACGACGACGACGGGCCCAGGAACGAGGCGACCCCGGCCCCGGCCTCCGACGCCTCCAAGAAGGCCGAAGAC
GCATCGCAGAAAACGCCACGCAAGAGCACCACCAAGGCCACAACCCCGTTCTGGAGGCCATTGACCGTGCCCCCC
GTCCCGAAAAAGGGCGAATTCGACGTGACTCGGCTGCGGAATAGCCAGTACTTTTTCTCATAG
Transcript >Hirsu2|9831
ATGTTTACCCGACAGACGGGCAGCGGCCTGCTGGTCCATCGAGGACTGGCAGCGAGGTCGGCCGGGCCTTCGCTG
AGGCGACCGGTCCTGCGATCCTGCGCCGTCTCGCTTGGTCGCCGTCTGGGCGCCTCCCTCCCGCCTCGGCCCTCA
CCGCGGCCTGAGCCTGAGGGTGGACGCGGCCGCGCGCTGCAGGGCAGAGGCCTGGCCACGGCCGTCGACGACTTC
GGCATCCAGACGTCGCCCTACGATCGCTTGAAAAGCTCGACATCGCCATCCTCTCAGGGGCCTCTCAAACTGTCC
CACATGCGACCCTTCGATGCCGCATCGCCACTGACCATCCCCGAGCCCCCCCCGCCGAAGCCCATGTCCAGGATG
AACATCTATGGGATCCCCGGCGACATCGACGACCTCATTCCCATTCTTCAAGCATGCCTGCAGGTGGGCAAGCTG
GACCGAGCGGCCCTCTTGATCCAGCGCCTCGAGCTTGTCGGAGCCAGTGCCGAGCAAAGGATCCTGTTCTGTAAC
CAGTATCTCCGCGTATCTCTGGAACAGATGCACTCGAAGCCCGCCAAGAAGCAGGCTGAAAAGCTGCACAGCTGG
TACCAGCTGCAAGTCCTGGACAAGAGACTGCCCCACACGGCCGAGACCATCGCTTGCATGCTCAAGGCCTCCCTC
ATGACGGAGCGAGGGCCGAGGCTCCAGCGCCTCGTCGACCGCTACATGGGCATGGCCCCCGGCGAGGCCGGCCTG
CGCGTCCTCGGCATGGCCCATATCCTCACCGATAGCGATCTTGCCGCCCTCACCAAACTCTGCCCCACGTACAAC
TACGCCGAGGAGACGGCTGAGCCCTCGGCCGCTCTCGAACCGCAGCATCAAGAGTCAGACGACGTCGCCCAAATG
CCACTCGATAGCACAGCGGCAGAGGCCGCCGTCAGGGCCGACGATGCGCCGGAGGTTCTGCCGACCCCACAGCGT
GGCCAAGGACTGGCGGCGCTGAGGCAAGGCCTGTCCATCTTCTCCGAGCTGCAAAACATCGACATATCCAAACTG
CCCCCTGAAGAGCAGAAGGATATTCAGCAACACTTGGAACACAACACCATCAGCGTCGCCGTTGAGAAATGGCGA
CGGGACCGCAAGACCATGCAAAAGGCCGGCATCACCCCGGCTTTCGGAGTGTCGAGCGCGCAGAGCACACTTTCG
CATTACATGGCTTCTTGGATGGCCGCCATGGAAGATCGCATCAACAAGGAGCTGGACTTGGTCGCGGTAGCGGAA
GAAAGAGAAACGAAAACAGCGCTGGATTTAGAACGCTGTCTGTATGGCCCGATACTCCGAATGTCCGACCCGTCT
CGGCTCGCCGCCCTGACCATCTTGTCCGTAATCAATCTTGGTGCCATGAATGGCATTGGGAAGGGCTTTGCAGTA
AGCCGGCTCGTCTCAAATCTTGCTAGGCAACTGCAGGAAGACATCGAGCTCCAGCGCCGAGATGAGATCAAGAAG
TCCAAGCGGCGCGGCAAGATCGAGCTCGCAGACCCGAATCCGGCTTCCGATTCCTCTCACCCCTCCGTCTCCGAC
CTCATCTCTGCCTCCGCTTCGACTGGCGAGGACGAGATAAAGATCATCGAACCAGCCGCCACAGAGGACGACGCC
CCGAAATTCTGGACGCCAACCATGCAGGTTCACATCGGCTCCGCCCTTCTCAGGCTGCTGATCGAAACGGCCAAG
ATTCCAGTCACTGCGACGCACCCAGTCACCGGCGAGCCTGTAAGCCAAGACCAGCCGGCTTTTACGCACATGATG
CAACCTCGCAGGGGCAAACGGGTCGGCGTCGTTTTCGTCAACAACCATCTGGCGCAGCATCTTCAGCGAGAGCCC
ATGGGCGACTTCATTGCCAAGCACTTGCCCATGGTTGCGGAGCCCAAGCCCTGGAAGAGTTTCAACGAAGGCGGC
TACTTGGTCAGTAGGACGAGCCTGATGAGAGTGAAATCCGGCGATATCGAACAGAGCCTGTACATCAAAGCGGCC
ATCCAGCGCGGAAGCATGGACAAGGTTTTCCAATCACTGGATGTGCTCGGCAAGACGGCCTGGCGGATAAACAGA
CAGACGCTCGACGTCATGATGGAAGCCTGGAACTCGGGCGAGGAAATAGCCAACATGCCAAAGCTCAACCCCGAG
TTCGAGTTGCCGCCCGAGCCAGACTCGTCGGCCGACCCGCTTCAGCGATTTCAGTGGCTCCTTGCGGTCAAGGCC
ATTGAGAACCAAAGGACGAGTCTGCATTCCCAGCGCTGCTTCATGAACCTCCAGCTAGAAATTGCGCGGGCCTAC
CGGAACCAGACAATCTACTTCCCGCACAACGTGGACTACAGAGGCCGCGCCTACCCGGTCCCGACCTACCTGAAC
CACATGGGTGCCGACCACACCCGTGCCCTCTTGATGTTCGCCGAGGGAAAGAAGCTGGGTGTCAGCGGTCTGAGG
TGGTTGAAGATTCACCTGGCCAACGTGTATGGTCTCGATAAAGCGAGCTTCAACGAGCGAGAGGCCTTCGCCGAC
GAGAACGTCGACAACATTGTCGACTCGGCCACGAACCCCTTCAAGGGGAGCCGCTGGTGGTTGGACGCCGAGGAC
CCGTGGCAATGCCTGACCGCCTGCTTCGAGCTCAAGGCAGCTCTGGAGCTTGCTGAGCCCACCGAGTTCGTCTCC
CATCTGCCCATCCACCAAGACGGCACCTGCAACGGCCTCCAGCACTACGCAGCCCTGGGCGGCGACACCCTGGGC
GCGAAGCAGGTCAACCTGGAGCCCGGCGATCGTCCGGCCGATGTTTACTCGGCCGTCGCGGAACTTGTGAAGCAG
GCGATCGATAAGGATTTCGAGGCGGGCAAGGATCTGTTCAAGGAAGCCGCAGTTGAGAAGGATGGCGACCAAGAT
GTCACGCGCCCAGATCCGAACTCACCCGCCAACTACGCCAGGATCCTACGAGGCAAGATCACGCGCAAGGTCGTC
AAGCAGACCGTCATGACGAATGTGTACGGTGTCACGTTTACGGGGGCCAAGAAGCAGGTCTGCAAGCAGCTCGAC
GCCCTGTACCCCAACTTGGGCAAGGAGAACGGTATCAGCAACCTGACCCTGGCGTGTTACATCGCGAGGCACATC
TTCAACGCCCTGGCATCCATGTTTCGAGGCGCCCACGACATCCAGTACTGGCTGGGTGAAGTCGGCGGCCGGATC
TGCAGGGCGTTGACGCCCTCTCAGCTGAAACAAATCGAGGACTTGTACGCGGCGAGTCAAGAGCCGGACGACGAG
GAATTCGAGGCCCCGAAGAAGGCCAAGAAGAACAAGAAGACGATCGACGCCGAGCTGGCGCAGCAATTCCGATCC
ACGGTCGTCTGGACCACGCCGCTGCAGATGCCGGTGGTGCAGCCGTATCGCGACACCAACATGAAGGAGGTCAGG
ACCTGCCTGCAGGCGGTCGTCTTCCCCATTCACGACCAGTCGAACCCGGTGAATCGCAGGAAGCAGCTGCAGGCA
TTCCCGCCCAACTTCATCCACTCCCTGGACGCGAGCCACATGATGCTGTCGGCCCTGGAGTGCCACGACCTCGGG
CTCACCTTCGCGGCCGTCCACGACTCGTTCTGGACGCACGCCAGCGACGTCGACACGATGAACACGGTGCTGCGG
GACGCCTTTATCCAGATACACGAGGAGGACGTCGTCGGCCGCCTGGCCGTGGAATTCGAGACGCGGCACAGGGGC
TCGCTGTACCTGACGCGCATCGACTCGTCGAGCCCGGTGGCGAAGAGGATCAAGGAATTTCGCAAGACCAGCGGA
AAGTCGATGATGGAAGAGCTTCTCATGGAGCACAGGCGGAACACGCTTCGGCTGTCCGGCGAGCCGGGGGATCTC
AAGAAGGCTGCCGAGATCGTCACGCCCGCCTCGCTGTACGAGGAGATGGAGGCGTCCGAGGTGGACGTCTCCATC
CAGGAGGACACCAAGGCCATGGGCATCGGAGAAATCTACGACTACTCGGAGCTGGCGACGCCCAGCCACCAGGTG
CTGGACGACGACGACGGGCCCAGGAACGAGGCGACCCCGGCCCCGGCCTCCGACGCCTCCAAGAAGGCCGAAGAC
GCATCGCAGAAAACGCCACGCAAGAGCACCACCAAGGCCACAACCCCGTTCTGGAGGCCATTGACCGTGCCCCCC
GTCCCGAAAAAGGGCGAATTCGACGTGACTCGGCTGCGGAATAGCCAGTACTTTTTCTCATAG
Gene >Hirsu2|9831
ATGTTTACCCGACAGACGGGCAGCGGCCTGCTGGTCCATCGAGGACTGGCAGCGAGGTCGGCCGGGCCTTCGCTG
AGGCGACCGGTCCTGCGATCCTGCGCCGTCTCGCTTGGTCGCCGTCTGGGCGCCTCCCTCCCGCCTCGGCCCTCA
CCGCGGCCTGAGCCTGAGGGTGGACGCGGCCGCGCGCTGCAGGGCAGAGGCCTGGCCACGGCCGTCGACGACTTC
GGCATCCAGACGTCGCCCTACGATCGCTTGAAAAGCTCGACATCGCCATCCTCTCAGGGGCCTCTCAAACTGTCC
CACATGCGACCCTTCGATGCCGCATCGCCACTGACCATCCCCGAGCCCCCCCCGCCGAAGCCCATGTCCAGGATG
AACATCTATGGGATCCCCGGCGACATCGACGACCTCATTCCCATTCTTCAAGCATGCCTGCAGGTGGGCAAGCTG
GACCGAGCGGCCCTCTTGATCCAGCGCCTCGAGCTTGTCGGAGCCAGTGCCGAGCAAAGGATCCTGTTCTGTAAC
CAGTATCTCCGCGTATCTCTGGAACAGATGCACTCGAAGCCCGCCAAGAAGCAGGCTGAAAAGCTGCACAGCTGG
TACCAGCTGCAAGTCCTGGACAAGAGACTGCCCCACACGGCCGAGACCATCGCTTGCATGCTCAAGGCCTCCCTC
ATGACGGAGCGAGGGCCGAGGCTCCAGCGCCTCGTCGACCGCTACATGGGCATGGCCCCCGGCGAGGCCGGCCTG
CGCGTCCTCGGCATGGCCCATATCCTCACCGATAGCGATCTTGCCGCCCTCACCAAACTCTGCCCCACGTACAAC
TACGCCGAGGAGACGGCTGAGCCCTCGGCCGCTCTCGAACCGCAGCATCAAGAGTCAGACGACGTCGCCCAAATG
CCACTCGATAGCACAGCGGCAGAGGCCGCCGTCAGGGCCGACGATGCGCCGGAGGTTCTGCCGACCCCACAGCGT
GGCCAAGGACTGGCGGCGCTGAGGCAAGGCCTGTCCATCTTCTCCGAGCTGCAAAACATCGACATATCCAAACTG
CCCCCTGAAGAGCAGAAGGATATTCAGCAACACTTGGAACACAACACCATCAGCGTCGCCGTTGAGAAATGGCGA
CGGGACCGCAAGACCATGCAAAAGGCCGGCATCACCCCGGCTTTCGGAGTGTCGAGCGCGCAGAGCACACTTTCG
CATTACATGGCTTCTTGGATGGCCGCCATGGAAGATCGCATCAACAAGGAGCTGGACTTGGTCGCGGTAGCGGAA
GAAAGAGAAACGAAAACAGCGCTGGATTTAGAACGCTGTCTGTATGGCCCGATACTCCGAATGTCCGACCCGTCT
CGGCTCGCCGCCCTGACCATCTTGTCCGTAATCAATCTTGGTGCCATGAATGGCATTGGGAAGGGCTTTGCAGTA
AGCCGGCTCGTCTCAAATCTTGCTAGGCAACTGCAGGAAGACATCGAGCTCCAGCGCCGAGATGAGATCAAGAAG
TCCAAGCGGCGCGGCAAGATCGAGCTCGCAGACCCGAATCCGGCTTCCGATTCCTCTCACCCCTCCGTCTCCGAC
CTCATCTCTGCCTCCGCTTCGACTGGCGAGGACGAGATAAAGATCATCGAACCAGCCGCCACAGAGGACGACGCC
CCGAAATTCTGGACGCCAACCATGCAGGTTCACATCGGCTCCGCCCTTCTCAGGCTGCTGATCGAAACGGCCAAG
ATTCCAGTCACTGCGACGCACCCAGTCACCGGCGAGCCTGTAAGCCAAGACCAGCCGGCTTTTACGCACATGATG
CAACCTCGCAGGGGCAAACGGGTCGGCGTCGTTTTCGTCAACAACCATCTGGCGCAGCATCTTCAGCGAGAGCCC
ATGGGCGACTTCATTGCCAAGCACTTGCCCATGGTTGCGGAGCCCAAGCCCTGGAAGAGTTTCAACGAAGGCGGC
TACTTGGTCAGTAGGACGAGCCTGATGAGAGTGAAATCCGGCGATATCGAACAGAGCCTGTACATCAAAGCGGCC
ATCCAGCGCGGAAGCATGGACAAGGTTTTCCAATCACTGGATGTGCTCGGCAAGACGGCCTGGCGGATAAACAGA
CAGACGCTCGACGTCATGATGGAAGCCTGGAACTCGGGCGAGGAAATAGCCAACATGCCAAAGCTCAACCCCGAG
TTCGAGTTGCCGCCCGAGCCAGACTCGTCGGCCGACCCGCTTCAGCGATTTCAGTGGCTCCTTGCGGTCAAGGCC
ATTGAGAACCAAAGGACGAGTCTGCATTCCCAGCGCTGCTTCATGAACCTCCAGCTAGAAATTGCGCGGGCCTAC
CGGAACCAGACAATCTACTTCCCGCACAACGTGGACTACAGAGGCCGCGCCTACCCGGTCCCGACCTACCTGAAC
CACATGGGTGCCGACCACACCCGTGCCCTCTTGATGTTCGCCGAGGGAAAGAAGCTGGGTGTCAGCGGTCTGAGG
TGGTTGAAGATTCACCTGGCCAACGTGTATGGTCTCGATAAAGCGAGCTTCAACGAGCGAGAGGCCTTCGCCGAC
GAGAACGTCGACAACATTGTCGACTCGGCCACGAACCCCTTCAAGGGGAGCCGCTGGTGGTTGGACGCCGAGGAC
CCGTGGCAATGCCTGACCGCCTGCTTCGAGCTCAAGGCAGCTCTGGAGCTTGCTGAGCCCACCGAGTTCGTCTCC
CATCTGCCCATCCACCAAGACGGCACCTGCAACGGCCTCCAGCACTACGCAGCCCTGGGCGGCGACACCCTGGGC
GCGAAGCAGGTCAACCTGGAGCCCGGCGATCGTCCGGCCGATGTTTACTCGGCCGTCGCGGAACTTGTGAAGCAG
GCGATCGATAAGGATTTCGAGGCGGGCAAGGATCTGTTCAAGGAAGCCGCAGTTGAGAAGGATGGCGACCAAGAT
GTCACGCGCCCAGATCCGAACTCACCCGCCAACTACGCCAGGATCCTACGAGGCAAGATCACGCGCAAGGTCGTC
AAGCAGACCGTCATGACGAATGTGTACGGTGTCACGTTTACGGGGGCCAAGAAGCAGGTCTGCAAGCAGCTCGAC
GCCCTGTACCCCAACTTGGGCAAGGAGAACGGTATCAGCAACCTGACCCTGGCGTGTTACATCGCGAGGCACATC
TTCAACGCCCTGGCATCCATGTTTCGAGGCGCCCACGACATCCAGTACTGGCTGGGTGAAGTCGGCGGCCGGATC
TGCAGGGCGTTGACGCCCTCTCAGCTGAAACAAATCGAGGACTTGTACGCGGCGAGTCAAGAGCCGGACGACGAG
GAATTCGAGGCCCCGAAGAAGGCCAAGAAGAACAAGAAGACGATCGACGCCGAGCTGGCGCAGCAATTCCGATCC
ACGGTCGTCTGGACCACGCCGCTGCAGATGCCGGTGGTGCAGCCGTATCGCGACACCAACATGAAGGAGGTCAGG
ACCTGCCTGCAGGCGGTCGTCTTCCCCATTCACGACCAGTCGAACCCGGTGAATCGCAGGAAGCAGCTGCAGGCA
TTCCCGCCCAACTTCATCCACTCCCTGGACGCGAGCCACATGATGCTGTCGGCCCTGGAGTGCCACGACCTCGGG
CTCACCTTCGCGGCCGTCCACGACTCGTTCTGGACGCACGCCAGCGACGTCGACACGATGAACACGGTGCTGCGG
GACGCCTTTATCCAGATACACGAGGAGGACGTCGTCGGCCGCCTGGCCGTGGAATTCGAGACGCGGCACAGGGGC
TCGCTGTACCTGACGCGCATCGACTCGTCGAGCCCGGTGGCGAAGAGGATCAAGGAATTTCGCAAGACCAGCGGA
AAGTCGATGATGGAAGAGCTTCTCATGGAGCACAGGCGGAACACGCTTCGGCTGTCCGGCGAGCCGGGGGATCTC
AAGAAGGCTGCCGAGATCGTCACGCCCGCCTCGCTGTACGAGGAGATGGAGGCGTCCGAGGTGGACGTCTCCATC
CAGGAGGACACCAAGGCCATGGGCATCGGAGAAATCTACGACTACTCGGAGCTGGCGACGCCCAGCCACCAGGTG
CTGGACGACGACGACGGGCCCAGGAACGAGGCGACCCCGGCCCCGGCCTCCGACGCCTCCAAGAAGGCCGAAGAC
GCATCGCAGAAAACGCCACGCAAGAGCACCACCAAGGCCACAACCCCGTTCTGGAGGCCATTGACCGTGCCCCCC
GTCCCGAAAAAGGTGAGCTTCCCCCCCCCCGTCTCGCTCCGGCGGAGGAGCTAACGCGCGGCGCAGGGCGAATTC
GACGTGACTCGGCTGCGGAATAGCCAGTACTTTTTCTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail