Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9830
Gene name
LocationContig_744:3424..4627
Strand+
Gene length (bp)1203
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01588 tRNA_bind Putative tRNA binding domain 8.5E-20 210 326
PF00043 GST_C Glutathione S-transferase, C-terminal domain 1.1E-04 25 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46672|ARC1_YEAST tRNA-aminoacylation cofactor ARC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC1 PE=1 SV=2 8 400 4.0E-56
sp|Q9P6K7|ARC1_SCHPO tRNA-aminoacylation cofactor arc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30C2.04 PE=3 SV=1 13 360 7.0E-42
sp|P31230|AIMP1_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Mus musculus GN=Aimp1 PE=1 SV=2 202 400 2.0E-37
sp|O54873|AIMP1_CRIGR Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Cricetulus griseus GN=AIMP1 PE=2 SV=1 195 400 9.0E-37
sp|Q12904|AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens GN=AIMP1 PE=1 SV=2 195 400 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46672|ARC1_YEAST tRNA-aminoacylation cofactor ARC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC1 PE=1 SV=2 8 400 4.0E-56
sp|Q9P6K7|ARC1_SCHPO tRNA-aminoacylation cofactor arc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30C2.04 PE=3 SV=1 13 360 7.0E-42
sp|P31230|AIMP1_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Mus musculus GN=Aimp1 PE=1 SV=2 202 400 2.0E-37
sp|O54873|AIMP1_CRIGR Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Cricetulus griseus GN=AIMP1 PE=2 SV=1 195 400 9.0E-37
sp|Q12904|AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens GN=AIMP1 PE=1 SV=2 195 400 2.0E-36
sp|Q9SVN5|SYMC_ARATH Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At4g13780 PE=2 SV=1 129 400 6.0E-35
sp|Q9ZTS1|SYM_ORYSJ Probable methionine--tRNA ligase OS=Oryza sativa subsp. japonica GN=Os06g0508700 PE=2 SV=2 154 400 3.0E-34
sp|Q6DIJ1|SYYC_XENTR Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis GN=yars PE=2 SV=1 176 360 1.0E-32
sp|Q7ZX51|SYYC_XENLA Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus laevis GN=yars PE=2 SV=1 178 360 9.0E-32
sp|Q4KM49|SYYC_RAT Tyrosine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Yars PE=2 SV=3 167 360 5.0E-31
sp|Q91WQ3|SYYC_MOUSE Tyrosine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Yars PE=1 SV=3 190 358 1.0E-30
sp|Q5R8T5|SYYC_PONAB Tyrosine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=YARS PE=2 SV=3 167 358 5.0E-30
sp|Q29465|SYYC_BOVIN Tyrosine--tRNA ligase, cytoplasmic OS=Bos taurus GN=YARS PE=2 SV=4 194 358 8.0E-30
sp|P54577|SYYC_HUMAN Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=YARS PE=1 SV=4 167 358 3.0E-29
sp|Q6TGS6|SYYC_DANRE Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio GN=yars PE=2 SV=2 205 387 3.0E-28
sp|Q5ZJ08|SYYC_CHICK Tyrosine--tRNA ligase, cytoplasmic OS=Gallus gallus GN=YARS PE=2 SV=1 190 360 1.0E-26
sp|Q20970|SYMC_CAEEL Methionine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=mrs-1 PE=3 SV=1 208 351 6.0E-25
sp|Q9V011|SYM_PYRAB Methionine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=metG PE=1 SV=1 206 294 1.0E-11
sp|P23395|SYM_THET8 Methionine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=metG PE=1 SV=2 181 295 5.0E-11
sp|Q8U221|SYM_PYRFU Methionine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=metG PE=3 SV=1 208 294 6.0E-11
sp|Q5JDZ7|SYM_THEKO Methionine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=metG PE=3 SV=1 206 294 8.0E-11
sp|B6YUN0|SYM_THEON Methionine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=metG PE=3 SV=1 208 328 4.0E-10
sp|Q74MZ1|SYM_NANEQ Methionine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=metG PE=3 SV=1 203 294 4.0E-10
sp|O58721|SYM_PYRHO Methionine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=metG PE=3 SV=1 206 294 5.0E-10
sp|A4FZL1|SYM_METM5 Methionine--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=metG PE=3 SV=1 208 294 5.0E-10
sp|Q73NT9|SYM_TREDE Methionine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=metG PE=3 SV=1 199 295 6.0E-10
sp|Q4ZPK6|SYM_PSEU2 Methionine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metG PE=3 SV=1 206 328 1.0E-09
sp|A6VIW5|SYM_METM7 Methionine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=metG PE=3 SV=1 208 294 4.0E-09
sp|Q6M0E5|SYM_METMP Methionine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=metG PE=3 SV=1 208 294 5.0E-09
sp|Q48LT7|SYM_PSE14 Methionine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metG PE=3 SV=1 206 328 6.0E-09
sp|A6URW2|SYM_METVS Methionine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=metG PE=3 SV=1 158 294 6.0E-09
sp|Q9RUF3|SYM_DEIRA Methionine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=metG PE=3 SV=1 158 294 1.0E-08
sp|B1J1D1|SYM_PSEPW Methionine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=metG PE=3 SV=1 206 328 2.0E-08
sp|Q1IDZ3|SYM_PSEE4 Methionine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=metG PE=3 SV=1 206 328 2.0E-08
sp|Q58659|SYM_METJA Methionine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=metG PE=3 SV=1 180 295 3.0E-08
sp|Q87XN0|SYM_PSESM Methionine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metG PE=3 SV=1 206 328 3.0E-08
sp|Q54X95|SYMC_DICDI Probable methionine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=metS PE=3 SV=1 208 294 3.0E-08
sp|O83776|SYM_TREPA Methionine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=metG PE=3 SV=1 178 327 6.0E-08
sp|Q3K7L0|SYM_PSEPF Methionine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=metG PE=3 SV=1 197 328 7.0E-08
sp|A1TZ66|SYM_MARHV Methionine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=metG PE=3 SV=1 158 328 2.0E-07
sp|B0KUD8|SYM_PSEPG Methionine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=metG PE=3 SV=1 206 328 2.0E-07
sp|Q88NV7|SYM_PSEPK Methionine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=metG PE=3 SV=1 206 328 2.0E-07
sp|A5VZI8|SYM_PSEP1 Methionine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=metG PE=3 SV=2 206 328 2.0E-07
sp|Q82WP0|SYM_NITEU Methionine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=metG PE=3 SV=1 192 328 2.0E-07
sp|Q46F18|SYM_METBF Methionine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=metG PE=3 SV=1 166 328 3.0E-07
sp|Q0AES9|SYM_NITEC Methionine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=metG PE=3 SV=1 208 328 4.0E-07
sp|Q92F90|SYM_LISIN Methionine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metG PE=3 SV=1 184 294 4.0E-07
sp|P42589|YGJH_ECOLI tRNA-binding protein YgjH OS=Escherichia coli (strain K12) GN=ygjH PE=1 SV=1 206 294 4.0E-07
sp|Q6L1M5|SYM_PICTO Methionine--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=metG PE=3 SV=1 208 333 4.0E-07
sp|Q2Y7P0|SYM_NITMU Methionine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=metG PE=3 SV=1 147 325 6.0E-07
sp|B7J2F0|SYM_BORBZ Methionine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=metG PE=3 SV=1 200 297 7.0E-07
sp|Q44951|SYM_BORBU Methionine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=metG PE=3 SV=2 200 297 7.0E-07
sp|Q4K758|SYM_PSEF5 Methionine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metG PE=3 SV=1 206 328 8.0E-07
sp|A6UUN1|SYM_META3 Methionine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=metG PE=3 SV=1 206 294 9.0E-07
sp|A0L8S1|SYM_MAGMM Methionine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=metG PE=3 SV=1 208 328 9.0E-07
sp|A4VJ05|SYM_PSEU5 Methionine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=metG PE=3 SV=2 194 328 1.0E-06
sp|C1DEF4|SYM_AZOVD Methionine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=metG PE=3 SV=1 185 329 1.0E-06
sp|A9L4F6|SYM_SHEB9 Methionine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=metG PE=3 SV=1 206 328 2.0E-06
sp|A9FBU8|SYM1_SORC5 Methionine--tRNA ligase 1 OS=Sorangium cellulosum (strain So ce56) GN=metG1 PE=3 SV=1 208 329 2.0E-06
sp|A3D5E5|SYM_SHEB5 Methionine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=metG PE=3 SV=1 206 328 2.0E-06
sp|A6WP56|SYM_SHEB8 Methionine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=metG PE=3 SV=1 174 328 2.0E-06
sp|B8E958|SYM_SHEB2 Methionine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=metG PE=3 SV=1 174 328 2.0E-06
sp|Q6FE36|SYM_ACIAD Methionine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metG PE=3 SV=1 208 328 4.0E-06
sp|A1SVA5|SYM_PSYIN Methionine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=metG PE=3 SV=1 202 328 6.0E-06
sp|Q0HVY2|SYM_SHESR Methionine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=metG PE=3 SV=1 206 328 6.0E-06
sp|Q724N6|SYM_LISMF Methionine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metG PE=3 SV=1 208 301 6.0E-06
sp|Q0HJN6|SYM_SHESM Methionine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=metG PE=3 SV=1 206 328 6.0E-06
sp|A0KW24|SYM_SHESA Methionine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=metG PE=3 SV=1 206 328 7.0E-06
sp|Q87N07|SYM_VIBPA Methionine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metG PE=3 SV=2 206 328 7.0E-06
sp|Q8EDX2|SYM_SHEON Methionine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=metG PE=3 SV=1 206 328 7.0E-06
sp|A4Y7K8|SYM_SHEPC Methionine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=metG PE=3 SV=1 206 328 7.0E-06
sp|A1RIY0|SYM_SHESW Methionine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=metG PE=3 SV=1 206 328 7.0E-06
sp|Q8YAF2|SYM_LISMO Methionine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metG PE=3 SV=1 208 301 7.0E-06
sp|Q6MMA3|SYM_BDEBA Methionine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=metG PE=3 SV=1 208 294 8.0E-06
sp|Q47IK0|SYM_DECAR Methionine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=metG PE=3 SV=1 181 328 8.0E-06
sp|C3KBZ7|SYM_PSEFS Methionine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=metG PE=3 SV=1 206 328 8.0E-06
sp|A0KKF6|SYM_AERHH Methionine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=metG PE=3 SV=1 175 328 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000049 tRNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003723 RNA binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9830
MASLRSQTYSATEEAEIQQWLTTSERLKSDQDKASMLDTLNSHLASRTTLLGSKPSRADVAVFEALAPLVANWSP
DERTGEQGRPHIVRHLDFVQNSSHFDLGLADARKVKVDHDDVRFVKAPVDAKAEKERLKKEKAAAAAAAGGKDSA
VLTDRTKENKADDKKGPAGAAAAAAAADGKPKKEKKEKAPKPQKAPAAAPAPLSPALIDLRVGHILKAVNHPDAD
SLYVSTIAMGDQPGDDTTEYEGQVCRTVCSGLNGLVPLAEMQGRRVVVVCNLKPVKMRGIKSSAMVLAASPRPSG
AAAADDDGHGGPVELVAPPEGSRPGDRLYFDGWAGQPEAQLNPKKKVWETLQPAFTTTPDREVAFDAAAVQQLGS
TAVGKLVTAAGGVCTVPSLRNAVVR*
Coding >Hirsu2|9830
ATGGCCTCGCTCCGCTCCCAGACGTACTCGGCCACCGAGGAGGCCGAGATCCAGCAGTGGCTCACGACGTCGGAG
CGGCTCAAGTCGGACCAGGACAAGGCGTCGATGCTCGACACGCTCAACAGCCACCTCGCCAGCCGCACCACCCTG
CTCGGCTCCAAGCCCAGCCGCGCCGACGTGGCCGTCTTCGAGGCGCTCGCGCCCCTCGTCGCCAACTGGTCGCCC
GACGAGCGCACCGGCGAGCAGGGCCGCCCGCACATCGTCCGCCACCTCGACTTCGTCCAGAACTCGTCCCACTTC
GACCTCGGCCTCGCCGACGCCCGCAAGGTCAAGGTCGACCACGACGACGTCCGATTCGTCAAGGCTCCCGTCGAC
GCCAAGGCCGAGAAGGAACGGCTGAAGAAGGAAAAGGCGGCGGCGGCGGCGGCGGCCGGCGGCAAGGACTCGGCC
GTGCTCACCGACCGCACCAAGGAGAACAAGGCGGATGACAAGAAGGGTCCTGCTGGCGCCGCTGCTGCTGCTGCC
GCTGCCGACGGCAAGCCCAAGAAGGAGAAGAAGGAGAAGGCGCCGAAGCCACAAAAGGCGCCGGCCGCGGCCCCT
GCGCCCCTGTCGCCGGCCCTCATCGACCTCCGCGTCGGCCACATCCTCAAGGCCGTCAACCATCCGGACGCCGAC
TCGCTCTACGTCTCGACCATCGCCATGGGCGACCAGCCGGGCGACGACACGACCGAGTACGAGGGCCAGGTCTGT
CGCACCGTCTGCTCCGGCCTCAACGGGCTCGTCCCGCTCGCCGAGATGCAGGGCCGCCGGGTGGTGGTGGTGTGC
AACCTCAAGCCGGTCAAGATGCGCGGCATCAAGTCGTCCGCCATGGTCCTGGCCGCGTCGCCGCGCCCGTCCGGC
GCCGCCGCCGCCGACGACGACGGCCACGGCGGCCCCGTCGAGCTCGTCGCCCCGCCCGAGGGCTCCCGGCCCGGC
GACCGCCTCTACTTCGACGGCTGGGCCGGCCAGCCCGAGGCCCAGCTCAACCCGAAGAAGAAGGTGTGGGAGACG
CTGCAGCCGGCCTTCACCACCACGCCCGACCGCGAGGTCGCCTTCGACGCCGCCGCCGTCCAGCAGCTCGGCAGC
ACGGCCGTCGGCAAGCTCGTCACCGCCGCCGGCGGCGTCTGCACCGTCCCCTCGCTGCGCAACGCCGTCGTCAGG
TAG
Transcript >Hirsu2|9830
ATGGCCTCGCTCCGCTCCCAGACGTACTCGGCCACCGAGGAGGCCGAGATCCAGCAGTGGCTCACGACGTCGGAG
CGGCTCAAGTCGGACCAGGACAAGGCGTCGATGCTCGACACGCTCAACAGCCACCTCGCCAGCCGCACCACCCTG
CTCGGCTCCAAGCCCAGCCGCGCCGACGTGGCCGTCTTCGAGGCGCTCGCGCCCCTCGTCGCCAACTGGTCGCCC
GACGAGCGCACCGGCGAGCAGGGCCGCCCGCACATCGTCCGCCACCTCGACTTCGTCCAGAACTCGTCCCACTTC
GACCTCGGCCTCGCCGACGCCCGCAAGGTCAAGGTCGACCACGACGACGTCCGATTCGTCAAGGCTCCCGTCGAC
GCCAAGGCCGAGAAGGAACGGCTGAAGAAGGAAAAGGCGGCGGCGGCGGCGGCGGCCGGCGGCAAGGACTCGGCC
GTGCTCACCGACCGCACCAAGGAGAACAAGGCGGATGACAAGAAGGGTCCTGCTGGCGCCGCTGCTGCTGCTGCC
GCTGCCGACGGCAAGCCCAAGAAGGAGAAGAAGGAGAAGGCGCCGAAGCCACAAAAGGCGCCGGCCGCGGCCCCT
GCGCCCCTGTCGCCGGCCCTCATCGACCTCCGCGTCGGCCACATCCTCAAGGCCGTCAACCATCCGGACGCCGAC
TCGCTCTACGTCTCGACCATCGCCATGGGCGACCAGCCGGGCGACGACACGACCGAGTACGAGGGCCAGGTCTGT
CGCACCGTCTGCTCCGGCCTCAACGGGCTCGTCCCGCTCGCCGAGATGCAGGGCCGCCGGGTGGTGGTGGTGTGC
AACCTCAAGCCGGTCAAGATGCGCGGCATCAAGTCGTCCGCCATGGTCCTGGCCGCGTCGCCGCGCCCGTCCGGC
GCCGCCGCCGCCGACGACGACGGCCACGGCGGCCCCGTCGAGCTCGTCGCCCCGCCCGAGGGCTCCCGGCCCGGC
GACCGCCTCTACTTCGACGGCTGGGCCGGCCAGCCCGAGGCCCAGCTCAACCCGAAGAAGAAGGTGTGGGAGACG
CTGCAGCCGGCCTTCACCACCACGCCCGACCGCGAGGTCGCCTTCGACGCCGCCGCCGTCCAGCAGCTCGGCAGC
ACGGCCGTCGGCAAGCTCGTCACCGCCGCCGGCGGCGTCTGCACCGTCCCCTCGCTGCGCAACGCCGTCGTCAGG
TAG
Gene >Hirsu2|9830
ATGGCCTCGCTCCGCTCCCAGACGTACTCGGCCACCGAGGAGGCCGAGATCCAGCAGTGGCTCACGACGTCGGAG
CGGCTCAAGTCGGACCAGGACAAGGCGTCGATGCTCGACACGCTCAACAGCCACCTCGCCAGCCGCACCACCCTG
CTCGGCTCCAAGCCCAGCCGCGCCGACGTGGCCGTCTTCGAGGCGCTCGCGCCCCTCGTCGCCAACTGGTCGCCC
GACGAGCGCACCGGCGAGCAGGGCCGCCCGCACATCGTCCGCCACCTCGACTTCGTCCAGAACTCGTCCCACTTC
GACCTCGGCCTCGCCGACGCCCGCAAGGTCAAGGTCGACCACGACGACGTCCGATTCGTCAAGGCTCCCGTCGAC
GCCAAGGCCGAGAAGGAACGGCTGAAGAAGGAAAAGGCGGCGGCGGCGGCGGCGGCCGGCGGCAAGGACTCGGCC
GTGCTCACCGACCGCACCAAGGAGAACAAGGCGGATGACAAGAAGGGTCCTGCTGGCGCCGCTGCTGCTGCTGCC
GCTGCCGACGGCAAGCCCAAGAAGGAGAAGAAGGAGAAGGCGCCGAAGCCACAAAAGGCGCCGGCCGCGGCCCCT
GCGCCCCTGTCGCCGGCCCTCATCGACCTCCGCGTCGGCCACATCCTCAAGGCCGTCAACCATCCGGACGCCGAC
TCGCTCTACGTCTCGACCATCGCCATGGGCGACCAGCCGGGCGACGACACGACCGAGTACGAGGGCCAGGTCTGT
CGCACCGTCTGCTCCGGCCTCAACGGGCTCGTCCCGCTCGCCGAGATGCAGGGCCGCCGGGTGGTGGTGGTGTGC
AACCTCAAGCCGGTCAAGATGCGCGGCATCAAGTCGTCCGCCATGGTCCTGGCCGCGTCGCCGCGCCCGTCCGGC
GCCGCCGCCGCCGACGACGACGGCCACGGCGGCCCCGTCGAGCTCGTCGCCCCGCCCGAGGGCTCCCGGCCCGGC
GACCGCCTCTACTTCGACGGCTGGGCCGGCCAGCCCGAGGCCCAGCTCAACCCGAAGAAGAAGGTGTGGGAGACG
CTGCAGCCGGCCTTCACCACCACGCCCGACCGCGAGGTCGCCTTCGACGCCGCCGCCGTCCAGCAGCTCGGCAGC
ACGGCCGTCGGCAAGCTCGTCACCGCCGCCGGCGGCGTCTGCACCGTCCCCTCGCTGCGCAACGCCGTCGTCAGG
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail