Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9826
Gene name
LocationContig_743:3283..5129
Strand-
Gene length (bp)1846
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03547 Mem_trans Membrane transport protein 6.4E-52 47 557

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38355|YB8B_YEAST Uncharacterized transporter YBR287W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR287W PE=1 SV=1 39 210 2.0E-50
sp|O14197|YDQ4_SCHPO Uncharacterized transporter C5D6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC5D6.04 PE=3 SV=1 47 262 5.0E-48
sp|P38355|YB8B_YEAST Uncharacterized transporter YBR287W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR287W PE=1 SV=1 394 570 9.0E-41
sp|O14197|YDQ4_SCHPO Uncharacterized transporter C5D6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC5D6.04 PE=3 SV=1 289 570 6.0E-35

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 78 97 19
3 107 129 22
4 388 410 22
5 430 452 22
6 473 495 22
7 508 530 22
8 543 565 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9826
MDSSGLYSGAVSYRLANLAQHAYDYPMAVLQAPTQGHPSLPHLCLLVFEAVLEVVCVSLPGYIIARLGHFDADKQ
KFLANLNVMLFTPCLIFTKLASQLNAEKLSELAIIPAIFVVQTLISWIVSTLIAKAFRFNKRASNFVTAMGVFGN
SNSLPISLVLSLSQTIKGLHWDRIPGDNDDEVGARGILYLLIFQQLGQLVRWSWGYHVLLATKDKYPEYQQQIAE
EGQCRYEEDHNEHEAQGLIEGVDGETEDEEEGHSVDSRTYVPAGRTPVAGTSRTSADSSDDDEFAPKKPASRHPT
APRTDQPPFGRDDEDAFTFPRVGNGNGAHSPEAKPDGIGARLKASVVGKFRSARAATAGYFGRLGQRFPRPVRLF
ASFVATAGAKTANFIWEFMNPPLWAMLIAVMVASIPSLQRLFFEEDSFVNNSVTSAVKSSGGVAVPLILVVLGAN
LARNTMAREDDHDPEEEQIGTKLLIASLLSRMVLPTAIMAPILALMAKYLPVSILDDPIFIVVCFLLTGAPSALQ
LAQICQINNVYEKTMGRVLFQSYVIWILPSTLVLVMMALEVVEWAAVS*
Coding >Hirsu2|9826
ATGGACTCTTCCGGTCTCTACTCGGGCGCGGTCTCGTATCGCCTCGCCAACCTCGCCCAACATGCCTACGACTAC
CCGATGGCCGTCCTCCAGGCCCCGACCCAGGGCCACCCTTCGCTCCCCCATCTGTGCCTCCTCGTCTTCGAGGCC
GTTCTCGAGGTCGTCTGCGTCAGCCTTCCGGGCTACATCATTGCCCGCCTGGGCCACTTTGATGCCGACAAGCAA
AAGTTCTTGGCCAATCTCAACGTCATGCTCTTCACCCCGTGCCTCATCTTCACCAAGCTGGCCTCCCAGCTCAAT
GCCGAGAAACTCTCCGAACTCGCCATTATCCCGGCCATTTTCGTCGTCCAGACCCTGATATCTTGGATCGTATCC
ACCTTGATCGCCAAGGCCTTCCGGTTCAACAAGCGGGCCTCCAATTTCGTCACGGCCATGGGCGTCTTTGGCAAC
TCTAATTCTCTGCCAATCTCTCTTGTCCTCTCCCTCTCGCAGACCATCAAGGGCCTTCATTGGGACAGAATCCCG
GGAGACAACGACGACGAGGTCGGTGCCCGGGGCATCCTGTACCTCCTCATCTTTCAGCAGCTCGGCCAGCTCGTC
CGATGGAGCTGGGGGTACCACGTCTTGCTGGCCACCAAGGACAAGTACCCTGAGTACCAGCAGCAGATTGCCGAG
GAGGGACAATGCCGCTATGAGGAGGACCACAACGAACACGAGGCGCAGGGACTCATCGAGGGCGTCGACGGCGAG
ACGGAAGACGAGGAGGAGGGTCATAGTGTGGACTCTCGAACGTACGTGCCCGCGGGCAGGACCCCGGTCGCTGGG
ACCTCGAGAACGTCGGCCGACTCGAGCGACGACGACGAGTTCGCTCCTAAGAAGCCCGCATCCCGACACCCGACG
GCGCCGCGAACCGACCAACCCCCCTTCGGCAGAGACGATGAAGATGCCTTCACCTTCCCCCGCGTCGGTAACGGT
AATGGCGCTCATTCGCCCGAGGCCAAGCCCGACGGCATTGGGGCTCGCCTTAAAGCATCCGTCGTTGGCAAGTTC
CGTTCCGCGCGAGCTGCTACTGCTGGCTATTTTGGGCGTCTCGGCCAGCGCTTTCCTCGGCCTGTTCGGCTGTTC
GCGTCCTTCGTGGCCACCGCCGGCGCCAAGACGGCCAACTTCATCTGGGAGTTTATGAATCCGCCTCTGTGGGCG
ATGCTGATCGCCGTCATGGTGGCCTCGATCCCCTCACTGCAGCGGCTCTTCTTTGAAGAGGATTCGTTTGTGAAC
AACAGCGTGACGAGTGCCGTCAAATCCAGCGGAGGGGTGGCCGTCCCCCTGATTCTCGTCGTTCTGGGAGCCAAT
CTGGCGCGAAATACCATGGCGCGCGAAGACGACCACGACCCCGAAGAGGAACAGATCGGAACCAAGCTCCTCATC
GCCTCCTTGCTGAGCCGCATGGTCCTACCCACTGCCATCATGGCCCCCATCCTGGCCTTGATGGCGAAATACCTG
CCCGTCAGCATCCTCGACGACCCCATCTTCATTGTCGTTTGCTTTCTCCTCACCGGCGCGCCCAGCGCCCTGCAG
CTGGCTCAGATCTGCCAGATCAACAACGTGTACGAGAAGACAATGGGCCGGGTCCTTTTCCAGAGCTACGTGATA
TGGATCCTTCCATCCACCTTGGTTCTTGTCATGATGGCACTCGAAGTCGTGGAGTGGGCGGCTGTCTCATGA
Transcript >Hirsu2|9826
ATGGACTCTTCCGGTCTCTACTCGGGCGCGGTCTCGTATCGCCTCGCCAACCTCGCCCAACATGCCTACGACTAC
CCGATGGCCGTCCTCCAGGCCCCGACCCAGGGCCACCCTTCGCTCCCCCATCTGTGCCTCCTCGTCTTCGAGGCC
GTTCTCGAGGTCGTCTGCGTCAGCCTTCCGGGCTACATCATTGCCCGCCTGGGCCACTTTGATGCCGACAAGCAA
AAGTTCTTGGCCAATCTCAACGTCATGCTCTTCACCCCGTGCCTCATCTTCACCAAGCTGGCCTCCCAGCTCAAT
GCCGAGAAACTCTCCGAACTCGCCATTATCCCGGCCATTTTCGTCGTCCAGACCCTGATATCTTGGATCGTATCC
ACCTTGATCGCCAAGGCCTTCCGGTTCAACAAGCGGGCCTCCAATTTCGTCACGGCCATGGGCGTCTTTGGCAAC
TCTAATTCTCTGCCAATCTCTCTTGTCCTCTCCCTCTCGCAGACCATCAAGGGCCTTCATTGGGACAGAATCCCG
GGAGACAACGACGACGAGGTCGGTGCCCGGGGCATCCTGTACCTCCTCATCTTTCAGCAGCTCGGCCAGCTCGTC
CGATGGAGCTGGGGGTACCACGTCTTGCTGGCCACCAAGGACAAGTACCCTGAGTACCAGCAGCAGATTGCCGAG
GAGGGACAATGCCGCTATGAGGAGGACCACAACGAACACGAGGCGCAGGGACTCATCGAGGGCGTCGACGGCGAG
ACGGAAGACGAGGAGGAGGGTCATAGTGTGGACTCTCGAACGTACGTGCCCGCGGGCAGGACCCCGGTCGCTGGG
ACCTCGAGAACGTCGGCCGACTCGAGCGACGACGACGAGTTCGCTCCTAAGAAGCCCGCATCCCGACACCCGACG
GCGCCGCGAACCGACCAACCCCCCTTCGGCAGAGACGATGAAGATGCCTTCACCTTCCCCCGCGTCGGTAACGGT
AATGGCGCTCATTCGCCCGAGGCCAAGCCCGACGGCATTGGGGCTCGCCTTAAAGCATCCGTCGTTGGCAAGTTC
CGTTCCGCGCGAGCTGCTACTGCTGGCTATTTTGGGCGTCTCGGCCAGCGCTTTCCTCGGCCTGTTCGGCTGTTC
GCGTCCTTCGTGGCCACCGCCGGCGCCAAGACGGCCAACTTCATCTGGGAGTTTATGAATCCGCCTCTGTGGGCG
ATGCTGATCGCCGTCATGGTGGCCTCGATCCCCTCACTGCAGCGGCTCTTCTTTGAAGAGGATTCGTTTGTGAAC
AACAGCGTGACGAGTGCCGTCAAATCCAGCGGAGGGGTGGCCGTCCCCCTGATTCTCGTCGTTCTGGGAGCCAAT
CTGGCGCGAAATACCATGGCGCGCGAAGACGACCACGACCCCGAAGAGGAACAGATCGGAACCAAGCTCCTCATC
GCCTCCTTGCTGAGCCGCATGGTCCTACCCACTGCCATCATGGCCCCCATCCTGGCCTTGATGGCGAAATACCTG
CCCGTCAGCATCCTCGACGACCCCATCTTCATTGTCGTTTGCTTTCTCCTCACCGGCGCGCCCAGCGCCCTGCAG
CTGGCTCAGATCTGCCAGATCAACAACGTGTACGAGAAGACAATGGGCCGGGTCCTTTTCCAGAGCTACGTGATA
TGGATCCTTCCATCCACCTTGGTTCTTGTCATGATGGCACTCGAAGTCGTGGAGTGGGCGGCTGTCTCATGA
Gene >Hirsu2|9826
ATGGACTCTTCCGGTCTCTACTCGGGCGCGGTCTCGTATCGCCTCGCCAACCTCGCCCAACATGCCTACGACTAC
CCGATGGCCGTCCTCCAGGCCCCGACCCAGGGCCACCCTTCGCTCCCCCATCTGTGCCTCCTCGTCTTCGAGGCC
GTTCTCGAGGTCGTCTGCGTCAGCCTTCCGGGCTACATCATTGCCCGCCTGGGCCACTTTGATGCCGACAAGCAA
AAGTTCTTGGCCAATCTCAACGTCATGCTCTTCACCCCGTGCCTCAGTAAGCCCTCGGTTTCGTCTCGTCTCTTT
CTTCTTCGGTCTGATCTGACCCAATCGTTCCGCAGTCTTCACCAAGCTGGCCTCCCAGCTCAATGCCGAGAAACT
CTCCGAACTCGCCATTATCCCGGCCATTTTCGTCGTCCAGACCCTGATATCTTGGATCGTATCCACCTTGATCGC
CAAGGCCTTCCGGTTCAACAAGCGGGCCTCCAATTTCGTCACGGCCATGGGCGTCTTTGGCAACTCTAATTCTCT
GCCAATCTCTCTTGTCCTCTCCCTCTCGCAGACCATCAAGGGCCTTCATTGGGACAGAATCCCGGGAGACAACGA
CGACGAGGTCGGTGCCCGGGGCATCCTGTACCTCCTCATCTTTCAGCAGCTCGGCCAGCTCGTCCGATGGAGCTG
GGGGTACCACGTCTTGCTGGCCACCAAGGACAAGTACCCTGAGTACCAGCAGCAGATTGCCGAGGAGGGACAATG
CCGCTATGAGGAGGACCACAACGAACACGAGGCGCAGGGACTCATCGAGGGCGTCGACGGCGAGACGGAAGACGA
GGAGGAGGGTCATAGTGTGGACTCTCGAACGTACGTGCCCGCGGGCAGGACCCCGGTCGCTGGGACCTCGAGAAC
GTCGGCCGACTCGAGCGACGACGACGAGTTCGCTCCTAAGAAGCCCGCATCCCGACACCCGACGGCGCCGCGAAC
CGACCAACCCCCCTTCGGCAGAGACGATGAAGATGCCTTCACCTTCCCCCGCGTCGGTAACGGTAATGGCGCTCA
TTCGCCCGAGGCCAAGCCCGACGGCATTGGGGCTCGCCTTAAAGCATCCGTCGTTGGCAAGTTCCGTTCCGCGCG
AGCTGCTACTGCTGGCTATTTTGGGCGTCTCGGCCAGCGCTTTCCTCGGCCTGTTCGGCTGTTCGCGTCCTTCGT
GGCCACCGCCGGCGCCAAGACGGCCAACTTCATCTGGGAGTTTATGAATCCGCCTCTGTGGGCGATGCTGATCGC
CGTCATGGTGGCCTCGATCCCCTCACTGCAGCGGCTCTTCTTTGAAGAGGATTCGTTTGTGAACAACAGCGTGAC
GAGTGCCGTCAAATCCAGCGGAGGGGTGGCCGTCCCCCTGATTCTCGTCGTTCTGGGAGCCAATCTGGCGCGAAA
TACCATGGCGCGCGAAGACGACCACGACCCCGAAGAGGAACAGATCGGAACCAAGCTCCTCATCGCCTCCTTGCT
GAGCCGCATGGTCCTACCCACTGCCATCATGGCCCCCATCCTGGCCTTGATGGCGAAATACCTGCCCGTCAGCAT
CCTCGACGACCCCATCTTCATTGTCGTTTGCTTTCTCCTCACCGGCGCGCCCAGCGCCCTGCAGCTGGCTCAGAT
CTGCCAGATCAACAACGTGTACGAGAAGACAATGGGCCGGGTCCTTTTCCAGAGCTACGTGATATGGTGAGTCAA
CGGTGCCAACTCCTGCCGTGCGCACACCGATGAAAGCTGACTGTGGACCAGGATCCTTCCATCCACCTTGGTTCT
TGTCATGATGGCACTCGAAGTCGTGGAGTGGGCGGCTGTCTCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail