Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9819
Gene name
LocationContig_741:10632..12976
Strand+
Gene length (bp)2344
Transcript length (bp)2082
Coding sequence length (bp)2082
Protein length (aa) 694

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07885 Ion_trans_2 Ion channel 2.5E-15 216 289
PF07885 Ion_trans_2 Ion channel 5.4E-20 378 455

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40310|TOK1_YEAST Outward-rectifier potassium channel TOK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOK1 PE=1 SV=1 15 466 6.0E-62
sp|P40310|TOK1_YEAST Outward-rectifier potassium channel TOK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOK1 PE=1 SV=1 205 339 3.0E-12
sp|Q9HB14|KCNKD_HUMAN Potassium channel subfamily K member 13 OS=Homo sapiens GN=KCNK13 PE=2 SV=2 235 427 2.0E-10
sp|Q8R5I0|KCNKF_RAT Potassium channel subfamily K member 15 OS=Rattus norvegicus GN=Kcnk15 PE=2 SV=1 331 459 2.0E-08
sp|Q9Y257|KCNK6_HUMAN Potassium channel subfamily K member 6 OS=Homo sapiens GN=KCNK6 PE=1 SV=1 369 438 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40310|TOK1_YEAST Outward-rectifier potassium channel TOK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOK1 PE=1 SV=1 15 466 6.0E-62
sp|P40310|TOK1_YEAST Outward-rectifier potassium channel TOK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOK1 PE=1 SV=1 205 339 3.0E-12
sp|Q9HB14|KCNKD_HUMAN Potassium channel subfamily K member 13 OS=Homo sapiens GN=KCNK13 PE=2 SV=2 235 427 2.0E-10
sp|Q8R5I0|KCNKF_RAT Potassium channel subfamily K member 15 OS=Rattus norvegicus GN=Kcnk15 PE=2 SV=1 331 459 2.0E-08
sp|Q9Y257|KCNK6_HUMAN Potassium channel subfamily K member 6 OS=Homo sapiens GN=KCNK6 PE=1 SV=1 369 438 1.0E-06
sp|Q9ES08|KCNK9_RAT Potassium channel subfamily K member 9 OS=Rattus norvegicus GN=Kcnk9 PE=1 SV=2 392 459 1.0E-06
sp|Q9JL58|KCNK9_CAVPO Potassium channel subfamily K member 9 OS=Cavia porcellus GN=KCNK9 PE=1 SV=1 392 459 1.0E-06
sp|O14649|KCNK3_HUMAN Potassium channel subfamily K member 3 OS=Homo sapiens GN=KCNK3 PE=1 SV=1 394 459 1.0E-06
sp|Q3LS21|KCNK9_MOUSE Potassium channel subfamily K member 9 OS=Mus musculus GN=Kcnk9 PE=2 SV=1 392 459 1.0E-06
sp|Q3LS21|KCNK9_MOUSE Potassium channel subfamily K member 9 OS=Mus musculus GN=Kcnk9 PE=2 SV=1 222 309 2.0E-06
sp|Q9NPC2|KCNK9_HUMAN Potassium channel subfamily K member 9 OS=Homo sapiens GN=KCNK9 PE=1 SV=1 392 459 2.0E-06
sp|Q9H427|KCNKF_HUMAN Potassium channel subfamily K member 15 OS=Homo sapiens GN=KCNK15 PE=1 SV=2 392 459 2.0E-06
sp|Q6UVM4|KCNT2_RAT Potassium channel subfamily T member 2 OS=Rattus norvegicus GN=Kcnt2 PE=1 SV=1 355 445 2.0E-06
sp|Q6UVM3|KCNT2_HUMAN Potassium channel subfamily T member 2 OS=Homo sapiens GN=KCNT2 PE=1 SV=1 355 445 2.0E-06
sp|O54912|KCNK3_RAT Potassium channel subfamily K member 3 OS=Rattus norvegicus GN=Kcnk3 PE=2 SV=1 394 459 4.0E-06
sp|O35111|KCNK3_MOUSE Potassium channel subfamily K member 3 OS=Mus musculus GN=Kcnk3 PE=1 SV=2 394 459 4.0E-06
sp|O17185|SUP9_CAEEL Two pore potassium channel protein sup-9 OS=Caenorhabditis elegans GN=sup-9 PE=1 SV=2 225 292 4.0E-06
sp|Q63ZI0|KCNK9_XENLA Potassium channel subfamily K member 9 OS=Xenopus laevis GN=kcnk9 PE=2 SV=1 392 459 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 93 115 22
3 130 152 22
4 173 195 22
5 210 229 19
6 236 258 22
7 268 290 22
8 368 390 22
9 400 419 19
10 432 454 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9819
MNHDDPENPPEPRLRASEAQLRPELPREVRFRHDNAHLVPARWWFASSAFPMVAGTLGPVASAFSICALVRPWRQ
LFPRGAQVQQTSFVTDPHWLTAINALQLVVALVSNLLLLLNMAKRVRFTLAQPITIVGWYISAICLVALTATAAG
PLDQGLQRPTEEYIWSEAFYYGIWAAILYFVDASLMVVTFWGAFLGYYDKDFNLTASQRTLMLQTIMVLAYLLLG
ALVFSKIEDWAYLDAVYWADVTLFTVGFGDFAASTHAGRALVVPYALVGIISLGLVVSSIRSLMLERGSRRLDAR
VQEKNRRRVLRTITRRGNDDILTPLPRELSLDADEDEADESEFGELRRRRSEFGLMRAIQNTASVRRRWLAMAIS
TTIWLLLWLVGAAIFRECERSSQSWTYFDSFYFCFVSLMTIGYGDRTPKSNAGKSFFVFWSLLALPTMTVLISNA
GDTVVKLVRDGTIRLGNVTILPGDHGASGSPDHFSLRRACRLALSGTSGVVRGLERLARGIEKSPSGDPSVDAGP
AGEPGQSEPGRPATRSGLLVPTTTAERSSLSRIRSRLDALPDGDDYRLLLISEIQGVSRHVRHDKSRRYTFEEWA
CRGIIVSGTAAATATATATTTXXXXXXXXXXXXXXXXXXXXDDGDEDDQLKWSWVGTRSPLVGGHEEGEWILERL
MDRLKESLWTAAHEADDG*
Coding >Hirsu2|9819
ATGAACCATGACGACCCGGAGAACCCCCCCGAACCGCGTCTTCGTGCCTCCGAGGCCCAGCTCCGGCCCGAACTC
CCCCGGGAGGTCCGGTTTCGACATGACAACGCCCACCTCGTCCCCGCCCGCTGGTGGTTCGCCTCCTCTGCCTTT
CCCATGGTGGCCGGCACGCTGGGCCCCGTCGCCTCGGCCTTCAGCATCTGCGCCCTCGTGCGCCCATGGCGGCAG
CTCTTCCCTCGCGGCGCACAAGTTCAGCAAACTTCCTTTGTGACCGACCCTCACTGGCTCACCGCCATCAATGCT
CTGCAGCTGGTCGTAGCCCTCGTGTCCAACCTTCTGCTCCTCCTGAACATGGCGAAGCGGGTGCGCTTCACCCTT
GCTCAGCCCATCACAATCGTCGGCTGGTACATCTCCGCAATCTGCCTCGTGGCCCTCACTGCTACCGCCGCCGGA
CCCCTCGACCAGGGCCTGCAGCGACCGACCGAGGAGTACATCTGGTCCGAGGCCTTCTACTACGGCATCTGGGCC
GCCATTCTCTACTTCGTCGACGCCTCGCTCATGGTCGTCACCTTTTGGGGCGCCTTTTTGGGCTACTACGATAAG
GACTTCAACCTGACGGCCAGTCAGCGCACCCTCATGCTGCAGACCATCATGGTCCTCGCCTACCTTCTCCTCGGC
GCCCTCGTCTTCTCCAAGATCGAGGACTGGGCCTACCTGGATGCCGTCTACTGGGCAGACGTGACGCTCTTCACC
GTCGGCTTCGGCGACTTCGCCGCCTCCACCCACGCCGGCCGCGCGCTGGTGGTCCCGTACGCACTCGTCGGCATC
ATCAGTCTCGGCCTGGTAGTCAGCTCGATCCGGAGCCTGATGCTCGAGCGCGGCAGTCGCCGGCTCGACGCCCGC
GTCCAGGAGAAGAACCGCCGCAGAGTGCTGCGGACCATAACGCGCAGGGGCAACGACGACATCCTGACCCCGCTC
CCCCGAGAGCTCTCCCTCGACGCGGACGAGGACGAGGCCGACGAGAGCGAGTTCGGCGAGCTCCGGCGGCGCCGG
TCCGAGTTCGGACTGATGCGCGCCATCCAGAATACGGCCTCGGTGCGGAGGAGGTGGCTGGCCATGGCCATCTCC
ACCACCATCTGGCTGCTCCTCTGGCTCGTCGGCGCCGCCATCTTCCGCGAATGCGAGCGGTCGTCGCAGTCCTGG
ACCTACTTCGACTCGTTCTACTTCTGCTTCGTCTCCCTCATGACCATCGGCTACGGCGACAGGACGCCCAAGTCC
AACGCCGGCAAGTCCTTCTTCGTCTTCTGGTCCCTGCTGGCCCTGCCCACCATGACGGTCCTCATCTCCAACGCC
GGCGACACCGTCGTCAAGCTCGTCCGGGACGGCACCATCCGCCTCGGCAACGTGACCATCCTGCCCGGCGACCAC
GGCGCGAGCGGGAGCCCCGACCACTTCAGCCTCCGCAGGGCCTGCCGCCTGGCCTTGAGCGGCACGAGCGGCGTC
GTGCGTGGTCTCGAGCGGCTGGCGCGCGGCATCGAGAAATCGCCGTCGGGGGACCCGTCGGTCGACGCCGGCCCG
GCCGGCGAGCCCGGCCAGTCGGAGCCCGGCCGGCCGGCCACCCGGAGCGGCCTGCTGGTGCCGACGACGACGGCG
GAGCGGAGCTCGCTGTCGCGCATCCGCAGCCGGCTCGACGCCCTGCCGGACGGCGACGACTACCGCCTGCTGCTC
ATCTCGGAGATCCAGGGCGTCAGCCGGCACGTGCGGCACGACAAGAGCCGGCGCTACACGTTCGAGGAGTGGGCC
TGCCGAGGCATCATCGTCAGCGGCACCGCCGCCGCCACGGCAACCGCCACCGCCACCACCACCANNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACGACGATGGCGACGAGGACGACCAGCTC
AAGTGGTCGTGGGTCGGGACCCGCAGCCCCCTGGTGGGCGGGCACGAGGAGGGCGAGTGGATCCTGGAGAGGCTG
ATGGACCGGCTCAAGGAGTCGCTGTGGACGGCGGCGCACGAGGCCGACGACGGCTGA
Transcript >Hirsu2|9819
ATGAACCATGACGACCCGGAGAACCCCCCCGAACCGCGTCTTCGTGCCTCCGAGGCCCAGCTCCGGCCCGAACTC
CCCCGGGAGGTCCGGTTTCGACATGACAACGCCCACCTCGTCCCCGCCCGCTGGTGGTTCGCCTCCTCTGCCTTT
CCCATGGTGGCCGGCACGCTGGGCCCCGTCGCCTCGGCCTTCAGCATCTGCGCCCTCGTGCGCCCATGGCGGCAG
CTCTTCCCTCGCGGCGCACAAGTTCAGCAAACTTCCTTTGTGACCGACCCTCACTGGCTCACCGCCATCAATGCT
CTGCAGCTGGTCGTAGCCCTCGTGTCCAACCTTCTGCTCCTCCTGAACATGGCGAAGCGGGTGCGCTTCACCCTT
GCTCAGCCCATCACAATCGTCGGCTGGTACATCTCCGCAATCTGCCTCGTGGCCCTCACTGCTACCGCCGCCGGA
CCCCTCGACCAGGGCCTGCAGCGACCGACCGAGGAGTACATCTGGTCCGAGGCCTTCTACTACGGCATCTGGGCC
GCCATTCTCTACTTCGTCGACGCCTCGCTCATGGTCGTCACCTTTTGGGGCGCCTTTTTGGGCTACTACGATAAG
GACTTCAACCTGACGGCCAGTCAGCGCACCCTCATGCTGCAGACCATCATGGTCCTCGCCTACCTTCTCCTCGGC
GCCCTCGTCTTCTCCAAGATCGAGGACTGGGCCTACCTGGATGCCGTCTACTGGGCAGACGTGACGCTCTTCACC
GTCGGCTTCGGCGACTTCGCCGCCTCCACCCACGCCGGCCGCGCGCTGGTGGTCCCGTACGCACTCGTCGGCATC
ATCAGTCTCGGCCTGGTAGTCAGCTCGATCCGGAGCCTGATGCTCGAGCGCGGCAGTCGCCGGCTCGACGCCCGC
GTCCAGGAGAAGAACCGCCGCAGAGTGCTGCGGACCATAACGCGCAGGGGCAACGACGACATCCTGACCCCGCTC
CCCCGAGAGCTCTCCCTCGACGCGGACGAGGACGAGGCCGACGAGAGCGAGTTCGGCGAGCTCCGGCGGCGCCGG
TCCGAGTTCGGACTGATGCGCGCCATCCAGAATACGGCCTCGGTGCGGAGGAGGTGGCTGGCCATGGCCATCTCC
ACCACCATCTGGCTGCTCCTCTGGCTCGTCGGCGCCGCCATCTTCCGCGAATGCGAGCGGTCGTCGCAGTCCTGG
ACCTACTTCGACTCGTTCTACTTCTGCTTCGTCTCCCTCATGACCATCGGCTACGGCGACAGGACGCCCAAGTCC
AACGCCGGCAAGTCCTTCTTCGTCTTCTGGTCCCTGCTGGCCCTGCCCACCATGACGGTCCTCATCTCCAACGCC
GGCGACACCGTCGTCAAGCTCGTCCGGGACGGCACCATCCGCCTCGGCAACGTGACCATCCTGCCCGGCGACCAC
GGCGCGAGCGGGAGCCCCGACCACTTCAGCCTCCGCAGGGCCTGCCGCCTGGCCTTGAGCGGCACGAGCGGCGTC
GTGCGTGGTCTCGAGCGGCTGGCGCGCGGCATCGAGAAATCGCCGTCGGGGGACCCGTCGGTCGACGCCGGCCCG
GCCGGCGAGCCCGGCCAGTCGGAGCCCGGCCGGCCGGCCACCCGGAGCGGCCTGCTGGTGCCGACGACGACGGCG
GAGCGGAGCTCGCTGTCGCGCATCCGCAGCCGGCTCGACGCCCTGCCGGACGGCGACGACTACCGCCTGCTGCTC
ATCTCGGAGATCCAGGGCGTCAGCCGGCACGTGCGGCACGACAAGAGCCGGCGCTACACGTTCGAGGAGTGGGCC
TGCCGAGGCATCATCGTCAGCGGCACCGCCGCCGCCACGGCAACCGCCACCGCCACCACCACCANNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACGACGATGGCGACGAGGACGACCAGCTC
AAGTGGTCGTGGGTCGGGACCCGCAGCCCCCTGGTGGGCGGGCACGAGGAGGGCGAGTGGATCCTGGAGAGGCTG
ATGGACCGGCTCAAGGAGTCGCTGTGGACGGCGGCGCACGAGGCCGACGACGGCTGA
Gene >Hirsu2|9819
ATGAACCATGACGACCCGGAGAACCCCCCCGAACCGCGTCTTCGTGCCTCCGAGGCCCAGCTCCGGCCCGAACTC
CCCCGGGAGGTCCGGTTTCGACATGACAACGCCCACCTCGTCCCCGCGTACGACCTCACCGCCCCTGACACCCCG
TCCGTCTCGTCGCTGACGCTCGCCTGCCCAGCCGCTGGTGGTTCGCCTCCTCTGCCTTTCCCATGGTGGCCGGCA
CGCTGGGCCCCGTCGCCTCGGCCTTCAGCATCTGCGCCCTCGTGCGCCCATGGCGGCAGCTCTTCCCTCGCGGCG
CACAAGTTCAGCAAACTTCCTTTGTGACCGACCCTCACTGGTGAGCCGAGGGGAAAGACGTGGCCCCGAACGTCC
CGCCATGCCCCGGCCTGTGGGCTACTGACGCCTTGCGCCAGGCTCACCGCCATCAATGCTCTGCAGCTGGTCGTA
GCCCTCGTGTCCAACCTTCTGCTCCTCCTGAACATGGCGAAGCGGGTGCGCTTCACCCTTGCTCAGCCCATCACA
ATCGTCGGCTGGTAAGTAGCTGCCTGTCCATGCGGCGCAGTCGTAAGCCTGAAGCCTCACCCCAGGTACATCTCC
GCAATCTGCCTCGTGGCCCTCACTGCTACCGCCGCCGGACCCCTCGACCAGGGCCTGCAGCGACCGACCGAGGAG
TACATCTGGTCCGAGGCCTTCTACTACGGCATCTGGGCCGCCATTCTCTACTTCGTCGACGCCTCGCTCATGGTC
GTCACCTTTTGGGGCGCCTTTTTGGGCTACTACGATAAGGACTTCAACCTGACGGCCAGTCAGCGCACCCTCATG
CTGCAGACCATCATGGTCCTCGCCTACCTTCTCCTCGGCGCCCTCGTCTTCTCCAAGATCGAGGACTGGGCCTAC
CTGGATGCCGTCTACTGGGCAGACGTGACGCTCTTCACCGTCGGCTTCGGCGACTTCGCCGCCTCCACCCACGCC
GGCCGCGCGCTGGTGGTCCCGTACGCACTCGTCGGCATCATCAGTCTCGGCCTGGTAGTCAGCTCGATCCGGAGC
CTGATGCTCGAGCGCGGCAGTCGCCGGCTCGACGCCCGCGTCCAGGAGAAGAACCGCCGCAGAGTGCTGCGGACC
ATAACGCGCAGGGGCAACGACGACATCCTGACCCCGCTCCCCCGAGAGCTCTCCCTCGACGCGGACGAGGACGAG
GCCGACGAGAGCGAGTTCGGCGAGCTCCGGCGGCGCCGGTCCGAGTTCGGACTGATGCGCGCCATCCAGAATACG
GCCTCGGTGCGGAGGAGGTGGCTGGCCATGGCCATCTCCACCACCATCTGGCTGCTCCTCTGGCTCGTCGGCGCC
GCCATCTTCCGCGAATGCGAGCGGTCGTCGCAGTCCTGGACCTACTTCGACTCGTTCTACTTCTGCTTCGTCTCC
CTCATGACCATCGGCTACGGCGACAGGACGCCCAAGTCCAACGCCGGCAAGTCCTTCTTCGTCTTCTGGTCCCTG
CTGGCCCTGCCCACCATGACGGTCCTCATCTCCAACGCCGGCGACACCGTCGTCAAGCTCGTCCGGGACGGCACC
ATCCGCCTCGGCAACGTGACCATCCTGCCCGGCGACCACGGCGCGAGCGGGAGCCCCGACCACTTCAGCCTCCGC
AGGGCCTGCCGCCTGGCCTTGAGCGGCACGAGCGGCGTCGTGCGTGGTCTCGAGCGGCTGGCGCGCGGCATCGAG
AAATCGCCGTCGGGGGACCCGTCGGTCGACGCCGGCCCGGCCGGCGAGCCCGGCCAGTCGGAGCCCGGCCGGCCG
GCCACCCGGAGCGGCCTGCTGGTGCCGACGACGACGGCGGAGCGGAGCTCGCTGTCGCGCATCCGCAGCCGGCTC
GACGCCCTGCCGGACGGCGACGACTACCGCCTGCTGCTCATCTCGGAGATCCAGGGCGTCAGCCGGCACGTGCGG
CACGACAAGAGCCGGCGCTACACGTTCGAGGAGTGGGCCTGGTACCTCGGCCTGATCGGCGAGGACGAGCGCGAC
CCGCAGATGCACGACAAGGCGAGGCCGCACAAGCCGCAGCCGAGGCATCATCGTCAGCGGCACCGCCGCCGCCAC
GGCAACCGCCACCGCCACCACCACCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNACGACGATGGCGACGAGGACGACCAGCTCAAGTGGTCGTGGGTCGGGACCCGCAGCCCCCTGGTGGG
CGGGCACGAGGAGGGCGAGTGGATCCTGGAGAGGCTGATGGACCGGCTCAAGGAGTCGCTGTGGACGGCGGCGCA
CGAGGCCGACGACGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail