Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9810
Gene name
LocationContig_740:1181..2687
Strand-
Gene length (bp)1506
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain 7.9E-19 40 193

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13612|NEP2_SCHPO NEDD8-specific protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nep2 PE=1 SV=1 21 227 2.0E-36
sp|O42980|NESP1_SCHPO NEDD8-specific protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nep1 PE=1 SV=2 15 227 3.0E-25
sp|Q54XR2|SENP8_DICDI Probable sentrin-specific protease 8 OS=Dictyostelium discoideum GN=senp8 PE=3 SV=1 22 189 4.0E-16
sp|Q9LSS7|RUBP1_ARATH NEDD8-specific protease 1 OS=Arabidopsis thaliana GN=NEDP1 PE=2 SV=1 12 181 3.0E-15
sp|Q9D2Z4|SENP8_MOUSE Sentrin-specific protease 8 OS=Mus musculus GN=Senp8 PE=1 SV=2 22 181 8.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13612|NEP2_SCHPO NEDD8-specific protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nep2 PE=1 SV=1 21 227 2.0E-36
sp|O42980|NESP1_SCHPO NEDD8-specific protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nep1 PE=1 SV=2 15 227 3.0E-25
sp|Q54XR2|SENP8_DICDI Probable sentrin-specific protease 8 OS=Dictyostelium discoideum GN=senp8 PE=3 SV=1 22 189 4.0E-16
sp|Q9LSS7|RUBP1_ARATH NEDD8-specific protease 1 OS=Arabidopsis thaliana GN=NEDP1 PE=2 SV=1 12 181 3.0E-15
sp|Q9D2Z4|SENP8_MOUSE Sentrin-specific protease 8 OS=Mus musculus GN=Senp8 PE=1 SV=2 22 181 8.0E-14
sp|Q96LD8|SENP8_HUMAN Sentrin-specific protease 8 OS=Homo sapiens GN=SENP8 PE=1 SV=1 22 181 1.0E-13
sp|Q5FVJ8|SENP8_RAT Sentrin-specific protease 8 OS=Rattus norvegicus GN=Senp8 PE=2 SV=1 22 181 2.0E-13
sp|Q02724|ULP1_YEAST Ubiquitin-like-specific protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULP1 PE=1 SV=1 26 183 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0008234 cysteine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3428 0.7977 0.5159 0.0503 0.1808 0.1179 0.0361 0.0091 0.0491 0.016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4653
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5764
Ophiocordyceps australis map64 (Brazil) OphauB2|791
Ophiocordyceps camponoti-floridani Ophcf2|03602
Ophiocordyceps camponoti-rufipedis Ophun1|3543
Ophiocordyceps kimflemingae Ophio5|38
Ophiocordyceps subramaniannii Hirsu2|9810 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9810
MPFRQRVARHFGDTLSPEKSYLSYYDVLLTVEDVKALKHDWLTDNNIAFWEEYLERETLSRYPQAHIVLLRPSMT
FLLMKEPDSRLVRAALPDFNRVTHVFLPINDNRNVGVAEGGSHWSLLLVSVIDGLAFHYDSLGGANYAEANFATR
KLAEMLGRPFRFINLEDCPQQENGSDCGVFVCLLMRHLLVKRLLSANAREKVSMSMAGKMVDSHGGRKEMLRIIE
NLRKEGERRRSATRHGSAAAFEQFIRDIEAGRLRVQPCKSSVKITVTARPQRAPSEPKPPASPRVQRKRELPGVK
KHPTAREKKVRMMRSRVAKVVRSKRAAKAAAKSKGKPAARPRPKPKPGSRKASRTATGAAAKKASTKQTEGKPAS
TRSSSKRTPFMAFTRVETRSQKRARLS*
Coding >Hirsu2|9810
ATGCCCTTTCGCCAGCGCGTTGCTCGCCACTTTGGCGACACGCTCTCGCCCGAGAAGTCGTACCTCAGCTACTAC
GATGTGCTCTTGACCGTCGAGGACGTCAAGGCGCTCAAGCATGACTGGCTCACCGACAACAACATTGCCTTCTGG
GAGGAGTATCTCGAGCGCGAGACCCTGTCGCGCTACCCCCAGGCCCACATCGTCCTCCTGCGTCCTAGCATGACG
TTTCTCCTCATGAAGGAGCCCGATTCCCGCCTGGTCCGCGCCGCCCTTCCCGACTTCAACAGGGTGACACACGTC
TTCCTGCCCATCAACGACAACCGTAACGTCGGTGTCGCCGAGGGCGGCAGCCACTGGTCGCTTCTGCTCGTCTCC
GTCATCGACGGCCTCGCCTTCCACTACGACTCGCTCGGCGGCGCCAACTACGCCGAGGCCAACTTCGCCACGCGC
AAGCTGGCCGAGATGCTCGGCCGCCCCTTCCGCTTCATCAACCTCGAGGACTGCCCCCAGCAGGAGAACGGCAGC
GACTGCGGCGTCTTCGTCTGCCTCCTCATGCGCCACCTGCTCGTCAAGCGCCTCCTCAGCGCCAACGCCCGCGAG
AAGGTGTCGATGAGCATGGCCGGCAAGATGGTCGACAGCCACGGCGGCCGCAAGGAGATGCTGCGCATCATCGAG
AACCTCCGCAAGGAGGGCGAGCGCCGGAGATCAGCGACCCGCCACGGCTCCGCCGCCGCCTTCGAACAGTTCATC
CGCGACATCGAAGCCGGCCGGCTCAGGGTGCAGCCATGCAAGTCCTCGGTCAAGATTACCGTCACGGCTCGGCCC
CAGCGCGCCCCTTCGGAACCCAAGCCGCCGGCCTCACCGCGGGTCCAGCGCAAGCGGGAGCTGCCGGGCGTCAAG
AAGCACCCAACCGCTCGCGAAAAGAAAGTGCGCATGATGCGCTCGAGGGTGGCCAAAGTTGTCCGCTCCAAGCGG
GCGGCCAAGGCTGCCGCCAAGTCCAAGGGCAAACCGGCCGCGAGGCCTCGGCCGAAGCCCAAGCCCGGCAGCAGG
AAGGCCTCGAGGACGGCGACGGGGGCCGCAGCCAAAAAGGCGTCGACGAAACAGACGGAGGGCAAGCCGGCCTCG
ACGCGCAGCTCGTCAAAGCGGACCCCCTTCATGGCATTTACCAGGGTTGAGACCCGAAGCCAGAAGCGGGCAAGG
CTGTCCTGA
Transcript >Hirsu2|9810
ATGCCCTTTCGCCAGCGCGTTGCTCGCCACTTTGGCGACACGCTCTCGCCCGAGAAGTCGTACCTCAGCTACTAC
GATGTGCTCTTGACCGTCGAGGACGTCAAGGCGCTCAAGCATGACTGGCTCACCGACAACAACATTGCCTTCTGG
GAGGAGTATCTCGAGCGCGAGACCCTGTCGCGCTACCCCCAGGCCCACATCGTCCTCCTGCGTCCTAGCATGACG
TTTCTCCTCATGAAGGAGCCCGATTCCCGCCTGGTCCGCGCCGCCCTTCCCGACTTCAACAGGGTGACACACGTC
TTCCTGCCCATCAACGACAACCGTAACGTCGGTGTCGCCGAGGGCGGCAGCCACTGGTCGCTTCTGCTCGTCTCC
GTCATCGACGGCCTCGCCTTCCACTACGACTCGCTCGGCGGCGCCAACTACGCCGAGGCCAACTTCGCCACGCGC
AAGCTGGCCGAGATGCTCGGCCGCCCCTTCCGCTTCATCAACCTCGAGGACTGCCCCCAGCAGGAGAACGGCAGC
GACTGCGGCGTCTTCGTCTGCCTCCTCATGCGCCACCTGCTCGTCAAGCGCCTCCTCAGCGCCAACGCCCGCGAG
AAGGTGTCGATGAGCATGGCCGGCAAGATGGTCGACAGCCACGGCGGCCGCAAGGAGATGCTGCGCATCATCGAG
AACCTCCGCAAGGAGGGCGAGCGCCGGAGATCAGCGACCCGCCACGGCTCCGCCGCCGCCTTCGAACAGTTCATC
CGCGACATCGAAGCCGGCCGGCTCAGGGTGCAGCCATGCAAGTCCTCGGTCAAGATTACCGTCACGGCTCGGCCC
CAGCGCGCCCCTTCGGAACCCAAGCCGCCGGCCTCACCGCGGGTCCAGCGCAAGCGGGAGCTGCCGGGCGTCAAG
AAGCACCCAACCGCTCGCGAAAAGAAAGTGCGCATGATGCGCTCGAGGGTGGCCAAAGTTGTCCGCTCCAAGCGG
GCGGCCAAGGCTGCCGCCAAGTCCAAGGGCAAACCGGCCGCGAGGCCTCGGCCGAAGCCCAAGCCCGGCAGCAGG
AAGGCCTCGAGGACGGCGACGGGGGCCGCAGCCAAAAAGGCGTCGACGAAACAGACGGAGGGCAAGCCGGCCTCG
ACGCGCAGCTCGTCAAAGCGGACCCCCTTCATGGCATTTACCAGGGTTGAGACCCGAAGCCAGAAGCGGGCAAGG
CTGTCCTGA
Gene >Hirsu2|9810
ATGCCCTTTCGCCAGCGCGTTGCTCGCCACTTTGGCGACACGGTACGTTCGCTTCCCGCCCTGCTCCCTGTCCCG
CGTCTCTCGTCGACCTCGGTCGCCCTCGACTGCCGAGCCTTGCTGACGGCTTCCACCCGCCCAGCTCTCGCCCGA
GAAGTCGTACCTCAGCTACTACGATGTGCTCTTGACCGTCGAGGACGTCAAGGCGCTCAAGCATGACTGGCTCAC
CGACAACAACATTGCCTTCTGGGAGGAGTATCTCGAGCGCGAGACCCTGTCGCGCTACCCCCAGGCCCACATCGT
CCTCCTGCGTCCTAGCATGACGTTTCTCCTCATGAAGGAGCCCGATTCCCGCCTGGTCCGCGCCGCCCTTCCCGA
CTTCAACAGGGTGACACACGTCTTCCTGCCCATCAACGACAACCGTAACGTCGGTGTCGCCGAGGGCGGCAGCCA
CTGGTCGCTTCTGCTCGTCTCCGTCATCGACGGCCTCGCCTTCCACTACGACTCGCTCGGCGGCGCCAACTACGC
CGAGGCCAACTTCGCCACGCGCAAGCTGGCCGAGATGCTCGGCCGCCCCTTCCGCTTCATCAACCTCGAGGACTG
CCCCCAGCAGGAGAACGGCAGCGACTGCGGCGTCTTCGTCTGCCTCCTCATGCGCCACCTGCTCGTCAAGCGCCT
CCTCAGCGCCAACGCCCGCGAGAAGGTGTCGATGAGCATGGCCGGCAAGATGGTCGACAGCCACGGCGGCCGCAA
GGAGATGCTGCGCATCATCGAGAACCTCCGCAAGGAGGGCGAGCGCCGGAGATCGTACGTTAGCCGCCTCATTGA
CCCCATCCTCCTGCCTCGCCTCTCCCCTCTTCTCCCATTTCCCCCCTTTTCCCCATCTCCCCCGACTACCCTGCA
CTCCTCCTCCCCCGCGCGAGGCGTGCCGGCGACTGACTGACGAGGGCGTACAGGAGAAGCACAAGCCCCTTCACC
AACAAGACGCCGCCGCGGATCGAATAGAGAGCGACCCGCCACGGCTCCGCCGCCGCCTTCGAACAGTTCATCCGC
GACATCGAAGCCGGCCGGCTCAGGGTGCAGCCATGCAAGTCCTCGGTCAAGATTACCGTCACGGCTCGGCCCCAG
CGCGCCCCTTCGGAACCCAAGCCGCCGGCCTCACCGCGGGTCCAGCGCAAGCGGGAGCTGCCGGGCGTCAAGAAG
CACCCAACCGCTCGCGAAAAGAAAGTGCGCATGATGCGCTCGAGGGTGGCCAAAGTTGTCCGCTCCAAGCGGGCG
GCCAAGGCTGCCGCCAAGTCCAAGGGCAAACCGGCCGCGAGGCCTCGGCCGAAGCCCAAGCCCGGCAGCAGGAAG
GCCTCGAGGACGGCGACGGGGGCCGCAGCCAAAAAGGCGTCGACGAAACAGACGGAGGGCAAGCCGGCCTCGACG
CGCAGCTCGTCAAAGCGGACCCCCTTCATGGCATTTACCAGGGTTGAGACCCGAAGCCAGAAGCGGGCAAGGCTG
TCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail