Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9809
Gene name
LocationContig_740:32..437
Strand+
Gene length (bp)405
Transcript length (bp)405
Coding sequence length (bp)405
Protein length (aa) 135

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15341 SLX9 Ribosome biogenesis protein SLX9 4.4E-11 1 122

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Yes
GO:0005730 nucleolus Yes
GO:0030686 90S preribosome Yes
GO:0030688 preribosome, small subunit precursor Yes
GO:0044238 primary metabolic process No
GO:0030684 preribosome No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044428 nuclear part No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0043226 organelle No
GO:0030490 maturation of SSU-rRNA No
GO:0044422 organelle part No
GO:0005575 cellular_component No
GO:0006364 rRNA processing No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0090304 nucleic acid metabolic process No
GO:0034470 ncRNA processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044464 cell part No
GO:0043228 non-membrane-bounded organelle No
GO:0044446 intracellular organelle part No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016072 rRNA metabolic process No
GO:0043229 intracellular organelle No
GO:1990904 ribonucleoprotein complex No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9809
MRGLADALPGLGADGEQPREGGARSRVPLHSLRSRPGALRRRETVVRGEMARFGANMARLARRSGDDEDDGSPSQ
QQPEKQQQPAQQREQQQQQQQQQKRELQQQKPAPDPRWAALRQYIASSMEQAPAFRPTT*
Coding >Hirsu2|9809
ATGCGTGGCCTTGCGGACGCCCTGCCTGGCCTCGGCGCCGACGGGGAGCAGCCGCGGGAGGGAGGTGCCCGCTCG
AGGGTGCCGCTGCATAGCTTGCGCAGTAGGCCCGGTGCCCTTCGCCGTAGGGAGACGGTCGTCCGTGGCGAGATG
GCTCGCTTTGGCGCCAATATGGCTCGTCTGGCCCGGCGGTCCGGCGACGACGAGGATGACGGCTCGCCGAGCCAG
CAGCAACCAGAAAAGCAGCAGCAGCCAGCACAACAACGAGAACAGCAACAGCAACAACAGCAACAGCAAAAACGA
GAACTGCAGCAGCAGAAGCCGGCCCCGGATCCCCGCTGGGCCGCCCTCCGCCAGTACATCGCCTCCTCCATGGAG
CAGGCTCCGGCCTTTCGCCCAACCACCTGA
Transcript >Hirsu2|9809
ATGCGTGGCCTTGCGGACGCCCTGCCTGGCCTCGGCGCCGACGGGGAGCAGCCGCGGGAGGGAGGTGCCCGCTCG
AGGGTGCCGCTGCATAGCTTGCGCAGTAGGCCCGGTGCCCTTCGCCGTAGGGAGACGGTCGTCCGTGGCGAGATG
GCTCGCTTTGGCGCCAATATGGCTCGTCTGGCCCGGCGGTCCGGCGACGACGAGGATGACGGCTCGCCGAGCCAG
CAGCAACCAGAAAAGCAGCAGCAGCCAGCACAACAACGAGAACAGCAACAGCAACAACAGCAACAGCAAAAACGA
GAACTGCAGCAGCAGAAGCCGGCCCCGGATCCCCGCTGGGCCGCCCTCCGCCAGTACATCGCCTCCTCCATGGAG
CAGGCTCCGGCCTTTCGCCCAACCACCTGA
Gene >Hirsu2|9809
ATGCGTGGCCTTGCGGACGCCCTGCCTGGCCTCGGCGCCGACGGGGAGCAGCCGCGGGAGGGAGGTGCCCGCTCG
AGGGTGCCGCTGCATAGCTTGCGCAGTAGGCCCGGTGCCCTTCGCCGTAGGGAGACGGTCGTCCGTGGCGAGATG
GCTCGCTTTGGCGCCAATATGGCTCGTCTGGCCCGGCGGTCCGGCGACGACGAGGATGACGGCTCGCCGAGCCAG
CAGCAACCAGAAAAGCAGCAGCAGCCAGCACAACAACGAGAACAGCAACAGCAACAACAGCAACAGCAAAAACGA
GAACTGCAGCAGCAGAAGCCGGCCCCGGATCCCCGCTGGGCCGCCCTCCGCCAGTACATCGCCTCCTCCATGGAG
CAGGCTCCGGCCTTTCGCCCAACCACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail