Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9807
Gene name
LocationContig_74:36674..39481
Strand+
Gene length (bp)2807
Transcript length (bp)2319
Coding sequence length (bp)2319
Protein length (aa) 773

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02436 PYC_OADA Conserved carboxylase domain 2.7E-60 536 734
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 2.0E-27 77 184
PF00682 HMGL-like HMGL-like 8.9E-23 339 512
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 6.8E-19 8 61

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 9 771 0.0E+00
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 9 768 0.0E+00
sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 9 772 0.0E+00
sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 8 771 0.0E+00
sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 8 771 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 9 771 0.0E+00
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 9 768 0.0E+00
sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 9 772 0.0E+00
sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 8 771 0.0E+00
sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 8 771 0.0E+00
sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 8 771 0.0E+00
sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 8 771 0.0E+00
sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 4 771 0.0E+00
sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 9 772 0.0E+00
sp|P78992|PYC_PICPA Pyruvate carboxylase OS=Komagataella pastoris GN=PYC1 PE=3 SV=1 9 771 0.0E+00
sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 9 771 0.0E+00
sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 9 771 0.0E+00
sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 9 771 0.0E+00
sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 9 768 0.0E+00
sp|Q58628|PYCB_METJA Pyruvate carboxylase subunit B OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycB PE=1 SV=1 277 734 1.0E-56
sp|O27179|PYCB_METTH Pyruvate carboxylase subunit B OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycB PE=1 SV=1 277 693 1.0E-52
sp|P13187|DCOA_KLEPN Oxaloacetate decarboxylase alpha chain OS=Klebsiella pneumoniae GN=oadA PE=3 SV=2 277 703 2.0E-52
sp|Q8XGX8|DCOA_SALTI Oxaloacetate decarboxylase alpha chain OS=Salmonella typhi GN=oadA1 PE=3 SV=3 277 703 2.0E-50
sp|Q03030|DCOA_SALTY Oxaloacetate decarboxylase alpha chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=oadA1 PE=3 SV=2 277 703 3.0E-50
sp|D3DJ41|2OCL_HYDTT 2-oxoglutarate carboxylase large subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiA PE=1 SV=1 274 701 5.0E-46
sp|Q70AC7|5S_PROFR Methylmalonyl-CoA carboxyltransferase 5S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=1 277 693 1.0E-42
sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 8 185 1.0E-40
sp|P49787|ACCC1_BACSU Biotin carboxylase 1 OS=Bacillus subtilis (strain 168) GN=accC1 PE=3 SV=3 10 184 7.0E-40
sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 8 184 3.0E-39
sp|Q06862|ACCC_NOSS1 Biotin carboxylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=accC PE=3 SV=1 10 185 2.0E-37
sp|Q8X9B6|ACCC_ECO57 Biotin carboxylase OS=Escherichia coli O157:H7 GN=accC PE=3 SV=1 10 184 8.0E-36
sp|P24182|ACCC_ECOLI Biotin carboxylase OS=Escherichia coli (strain K12) GN=accC PE=1 SV=2 10 184 9.0E-36
sp|D3DJ42|2OCS_HYDTT 2-oxoglutarate carboxylase small subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiB PE=1 SV=1 9 207 6.0E-35
sp|O30019|PYCA_ARCFU Pyruvate carboxylase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pycA PE=3 SV=1 9 185 7.0E-35
sp|P43873|ACCC_HAEIN Biotin carboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=accC PE=1 SV=1 10 184 3.0E-33
sp|O34544|ACCC2_BACSU Biotin carboxylase 2 OS=Bacillus subtilis (strain 168) GN=accC2 PE=3 SV=1 9 183 1.0E-32
sp|Q9KDS9|ACCC_BACHD Biotin carboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=accC PE=3 SV=1 9 185 1.0E-32
sp|P9WPQ3|BCCA_MYCTU Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accA1 PE=1 SV=1 9 185 2.0E-32
sp|P9WPQ2|BCCA_MYCTO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accA1 PE=3 SV=1 9 185 2.0E-32
sp|P0A509|BCCA_MYCBO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accA1 PE=3 SV=1 9 185 2.0E-32
sp|P37798|ACCC_PSEAE Biotin carboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=accC PE=1 SV=1 10 184 2.0E-30
sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 9 185 2.0E-29
sp|Q5I0C3|MCCA_RAT Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Mccc1 PE=1 SV=1 10 194 5.0E-29
sp|Q99MR8|MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus GN=Mccc1 PE=1 SV=2 10 194 9.0E-29
sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens GN=PCCA PE=1 SV=4 9 229 1.0E-28
sp|Q91ZA3|PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus GN=Pcca PE=1 SV=2 9 219 2.0E-28
sp|O52058|ACCC_ALLVD Biotin carboxylase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=accC PE=3 SV=2 10 184 2.0E-28
sp|Q612F5|PCCA_CAEBR Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis briggsae GN=pcca-1 PE=3 SV=1 8 216 3.0E-27
sp|Q54KE6|MCCA_DICDI Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=mccA PE=3 SV=1 10 183 4.0E-27
sp|P14882|PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus GN=Pcca PE=1 SV=3 9 219 5.0E-27
sp|O04983|ACCC_ARATH Biotin carboxylase, chloroplastic OS=Arabidopsis thaliana GN=CAC2 PE=1 SV=1 11 183 1.0E-26
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 9 184 2.0E-26
sp|B9HBA8|ACCC1_POPTR Biotin carboxylase 1, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_831870 PE=2 SV=1 11 183 3.0E-26
sp|Q19842|PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans GN=pcca-1 PE=1 SV=1 8 191 4.0E-26
sp|B9N843|ACCC2_POPTR Biotin carboxylase 2, chloroplastic OS=Populus trichocarpa GN=POPTR_0018s14250g PE=2 SV=2 11 183 7.0E-26
sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens GN=MCCC1 PE=1 SV=3 10 183 2.0E-25
sp|Q2QMG2|MCCA_ORYSJ Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2 9 211 4.0E-25
sp|P46392|BCCA_MYCLE Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium leprae (strain TN) GN=bccA PE=3 SV=2 10 163 1.0E-21
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 10 199 3.0E-21
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 10 184 3.0E-21
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 9 185 2.0E-20
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 9 185 2.0E-20
sp|C8ZF72|HFA1_YEAS8 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HFA1 PE=3 SV=2 9 185 2.0E-20
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 9 185 2.0E-20
sp|P78820|ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut6 PE=1 SV=2 9 184 8.0E-20
sp|B3LM95|HFA1_YEAS1 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HFA1 PE=3 SV=2 9 185 8.0E-20
sp|O00763|ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens GN=ACACB PE=1 SV=3 9 190 3.0E-19
sp|P38095|LAMA_EMENI Putative urea carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamA PE=2 SV=2 9 185 3.0E-19
sp|E9Q4Z2|ACACB_MOUSE Acetyl-CoA carboxylase 2 OS=Mus musculus GN=Acacb PE=1 SV=1 9 190 6.0E-19
sp|Q00955|ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACC1 PE=1 SV=2 9 185 1.0E-18
sp|Q13085|ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens GN=ACACA PE=1 SV=2 9 184 1.0E-18
sp|Q9TTS3|ACACA_BOVIN Acetyl-CoA carboxylase 1 OS=Bos taurus GN=ACACA PE=2 SV=1 9 184 2.0E-18
sp|P11029|ACAC_CHICK Acetyl-CoA carboxylase OS=Gallus gallus GN=ACAC PE=1 SV=1 9 184 3.0E-18
sp|Q28559|ACACA_SHEEP Acetyl-CoA carboxylase 1 OS=Ovis aries GN=ACACA PE=2 SV=1 9 184 3.0E-18
sp|Q5SWU9|ACACA_MOUSE Acetyl-CoA carboxylase 1 OS=Mus musculus GN=Acaca PE=1 SV=1 9 184 4.0E-18
sp|P11497|ACACA_RAT Acetyl-CoA carboxylase 1 OS=Rattus norvegicus GN=Acaca PE=1 SV=1 9 184 4.0E-18
sp|Q54J08|ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum GN=accA PE=3 SV=1 10 184 2.0E-15
sp|F4I1L3|ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana GN=ACC2 PE=2 SV=1 10 184 2.0E-13
sp|Q8S6N5|ACC1_ORYSJ Acetyl-CoA carboxylase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=3 SV=1 10 184 3.0E-13
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 10 184 1.0E-12
sp|Q8ZW35|LEU1_PYRAE Probable 2-isopropylmalate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuA PE=3 SV=1 341 518 2.0E-09
sp|Q8TW28|AKSA_METKA Putative homocitrate synthase AksA OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aksA PE=3 SV=1 263 514 1.0E-06
sp|A8AB61|LEU1_IGNH4 Probable 2-isopropylmalate synthase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=leuA PE=3 SV=1 341 503 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003824 catalytic activity Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9807
MTWRHVTENAGTVEFLVENEEFYFIEMNPRIQVEHTITEEITGIDIVSAQLRIARGATLAELGLEQDKIEVKGYA
IQCRVTTEIPSQGFRPDTGTIGGCCLPVGRGVRLDHSDCFLGARISPFYDSLLVKCICSGPDINSTIRRATRALG
EFDIRGIQTNIEFLIRLLAHETFAAGDCWTSFIDDAPDILPSHTYHDEAQGLMRFLADAAVNGSRIQGQVKEPAL
KRDIEIGRMVNPKSGEEVNTAEPCHWGWRNILLRHGPREFARQIRAHGRALITDTTWRDGQQSLLATRVRSRDLE
AIAMHTSHAYREAYSLESWGGATFDVMLRFLLPDNALFHFVKQAKDAGIDIFRVFDSLNDLENLKTGIDAVQAAG
GLVEGAIMYTGDMLEFGTKYNLDYYMRIVDHLVDFGSHVIAVKSMSGVMKPAAGRALVRAIRAKYPDMPLHMHTH
DTNGAGTATMVACVEEGADIVDTAIDSMSGSTSQPAASAVIASLENTGFDSALSLDQIRVIDSYWAQLRLVYAGF
DADLRSPDPTIYKHEIPGGQYSNLLFQARQNGLGNQWADTLKAYEEANHLLGDIIKATPTSKAVGDLAQFMVDRK
LSASQVQERASTLDFPRSVIEYFEGLMGQPFDGFPEPFRTNVLRGRDSDIRSRPGLTMVPIDFDRVRREIKEKYP
ERPVTEDDIASYVMYPEVYMDYRQARRDFGDLTALRTPDFLSPPEVGQEVQMKIDEREFIMEMIAIRPPEVTTGK
CEVFFRLNGQVCSVVVQDDKGK*
Coding >Hirsu2|9807
ATGACTTGGCGTCATGTCACAGAGAACGCGGGTACAGTGGAGTTTCTCGTTGAGAATGAGGAATTCTACTTCATC
GAGATGAACCCTCGGATACAGGTTGAGCATACCATTACTGAGGAAATAACTGGGATCGACATAGTGTCTGCGCAA
TTACGGATTGCTCGAGGGGCGACGCTGGCCGAGCTAGGATTAGAGCAGGACAAGATTGAGGTCAAAGGATACGCA
ATTCAGTGTCGTGTCACGACTGAAATCCCTTCGCAGGGATTCCGTCCGGATACTGGCACAATCGGGGGATGTTGC
TTGCCGGTTGGCAGGGGTGTCCGACTTGACCATAGCGACTGCTTTCTTGGGGCGCGAATCAGCCCCTTCTACGAC
TCGCTTCTGGTCAAGTGCATCTGTTCTGGCCCCGACATAAATTCTACCATAAGAAGAGCGACTAGAGCCTTGGGC
GAGTTCGATATTCGAGGGATTCAAACTAACATCGAATTTCTAATCCGCCTTCTTGCACATGAGACCTTTGCTGCA
GGCGACTGCTGGACGTCATTCATCGATGACGCCCCGGATATACTGCCTTCGCACACGTACCATGACGAGGCTCAG
GGATTAATGCGGTTTCTGGCCGATGCTGCCGTCAACGGCAGTCGCATTCAGGGACAAGTGAAAGAGCCCGCATTA
AAGAGAGACATCGAAATTGGACGCATGGTCAACCCAAAGTCAGGCGAAGAGGTCAATACCGCCGAGCCCTGTCAT
TGGGGATGGCGGAACATACTTCTTCGACATGGGCCGCGCGAGTTCGCCCGTCAGATCCGGGCTCATGGTAGAGCG
CTGATCACTGACACCACCTGGCGAGACGGGCAGCAATCCCTTCTGGCGACCCGGGTGCGGAGCAGAGACTTGGAG
GCGATAGCTATGCACACAAGTCACGCGTACCGCGAGGCATACAGTCTCGAGAGTTGGGGTGGCGCCACATTTGAC
GTTATGCTCCGATTCCTATTGCCTGATAATGCTCTCTTCCACTTTGTCAAGCAAGCAAAGGATGCGGGTATTGAC
ATATTTCGAGTTTTCGATAGCCTGAACGACCTAGAAAACCTCAAAACAGGCATCGACGCTGTTCAAGCGGCTGGA
GGCTTGGTCGAGGGAGCCATCATGTACACCGGCGACATGCTTGAGTTCGGCACAAAATACAACCTTGACTACTAT
ATGAGAATTGTGGACCATCTAGTCGACTTTGGATCACATGTCATTGCAGTTAAGTCTATGTCGGGAGTTATGAAG
CCGGCAGCAGGTCGAGCACTAGTGCGAGCCATTCGAGCTAAATACCCCGATATGCCTCTTCATATGCACACTCAC
GATACGAACGGGGCCGGCACCGCGACAATGGTTGCTTGCGTTGAAGAAGGCGCAGACATTGTCGATACGGCCATA
GATAGCATGTCCGGATCAACGTCTCAGCCTGCGGCCAGTGCTGTTATTGCCTCGCTGGAAAATACGGGCTTCGAT
TCAGCCCTATCTCTAGACCAAATACGAGTAATCGATTCATATTGGGCTCAGCTTCGACTGGTTTACGCGGGGTTC
GACGCTGACTTGCGATCGCCCGACCCCACCATCTACAAACACGAGATTCCGGGCGGCCAGTATTCAAATCTTCTG
TTTCAGGCGCGCCAAAATGGGTTGGGCAACCAATGGGCAGATACCCTGAAGGCGTACGAAGAGGCGAACCACCTT
TTAGGCGATATTATAAAGGCTACGCCAACGTCTAAAGCGGTGGGAGACTTGGCTCAGTTCATGGTCGACCGCAAG
CTTTCCGCGTCACAAGTACAGGAACGTGCTTCAACTCTGGACTTTCCAAGATCTGTCATCGAATATTTCGAGGGT
TTAATGGGCCAGCCGTTCGATGGCTTCCCAGAGCCATTCCGGACCAACGTCCTCCGAGGCCGCGACAGCGATATA
AGGAGTAGGCCCGGTTTAACGATGGTGCCAATCGACTTTGACCGCGTTCGACGAGAGATAAAGGAGAAGTATCCA
GAGAGACCGGTAACAGAAGACGATATTGCCAGCTATGTCATGTATCCGGAAGTATATATGGACTACCGACAGGCA
CGGCGGGATTTCGGCGATCTCACGGCACTGCGGACGCCCGACTTTCTTTCTCCGCCGGAGGTCGGTCAAGAAGTA
CAAATGAAAATCGACGAAAGAGAATTTATTATGGAGATGATAGCAATTCGGCCTCCAGAAGTTACGACTGGAAAG
TGTGAGGTTTTTTTCCGGCTCAATGGCCAAGTCTGTTCGGTGGTCGTGCAGGACGATAAGGGTAAGTGA
Transcript >Hirsu2|9807
ATGACTTGGCGTCATGTCACAGAGAACGCGGGTACAGTGGAGTTTCTCGTTGAGAATGAGGAATTCTACTTCATC
GAGATGAACCCTCGGATACAGGTTGAGCATACCATTACTGAGGAAATAACTGGGATCGACATAGTGTCTGCGCAA
TTACGGATTGCTCGAGGGGCGACGCTGGCCGAGCTAGGATTAGAGCAGGACAAGATTGAGGTCAAAGGATACGCA
ATTCAGTGTCGTGTCACGACTGAAATCCCTTCGCAGGGATTCCGTCCGGATACTGGCACAATCGGGGGATGTTGC
TTGCCGGTTGGCAGGGGTGTCCGACTTGACCATAGCGACTGCTTTCTTGGGGCGCGAATCAGCCCCTTCTACGAC
TCGCTTCTGGTCAAGTGCATCTGTTCTGGCCCCGACATAAATTCTACCATAAGAAGAGCGACTAGAGCCTTGGGC
GAGTTCGATATTCGAGGGATTCAAACTAACATCGAATTTCTAATCCGCCTTCTTGCACATGAGACCTTTGCTGCA
GGCGACTGCTGGACGTCATTCATCGATGACGCCCCGGATATACTGCCTTCGCACACGTACCATGACGAGGCTCAG
GGATTAATGCGGTTTCTGGCCGATGCTGCCGTCAACGGCAGTCGCATTCAGGGACAAGTGAAAGAGCCCGCATTA
AAGAGAGACATCGAAATTGGACGCATGGTCAACCCAAAGTCAGGCGAAGAGGTCAATACCGCCGAGCCCTGTCAT
TGGGGATGGCGGAACATACTTCTTCGACATGGGCCGCGCGAGTTCGCCCGTCAGATCCGGGCTCATGGTAGAGCG
CTGATCACTGACACCACCTGGCGAGACGGGCAGCAATCCCTTCTGGCGACCCGGGTGCGGAGCAGAGACTTGGAG
GCGATAGCTATGCACACAAGTCACGCGTACCGCGAGGCATACAGTCTCGAGAGTTGGGGTGGCGCCACATTTGAC
GTTATGCTCCGATTCCTATTGCCTGATAATGCTCTCTTCCACTTTGTCAAGCAAGCAAAGGATGCGGGTATTGAC
ATATTTCGAGTTTTCGATAGCCTGAACGACCTAGAAAACCTCAAAACAGGCATCGACGCTGTTCAAGCGGCTGGA
GGCTTGGTCGAGGGAGCCATCATGTACACCGGCGACATGCTTGAGTTCGGCACAAAATACAACCTTGACTACTAT
ATGAGAATTGTGGACCATCTAGTCGACTTTGGATCACATGTCATTGCAGTTAAGTCTATGTCGGGAGTTATGAAG
CCGGCAGCAGGTCGAGCACTAGTGCGAGCCATTCGAGCTAAATACCCCGATATGCCTCTTCATATGCACACTCAC
GATACGAACGGGGCCGGCACCGCGACAATGGTTGCTTGCGTTGAAGAAGGCGCAGACATTGTCGATACGGCCATA
GATAGCATGTCCGGATCAACGTCTCAGCCTGCGGCCAGTGCTGTTATTGCCTCGCTGGAAAATACGGGCTTCGAT
TCAGCCCTATCTCTAGACCAAATACGAGTAATCGATTCATATTGGGCTCAGCTTCGACTGGTTTACGCGGGGTTC
GACGCTGACTTGCGATCGCCCGACCCCACCATCTACAAACACGAGATTCCGGGCGGCCAGTATTCAAATCTTCTG
TTTCAGGCGCGCCAAAATGGGTTGGGCAACCAATGGGCAGATACCCTGAAGGCGTACGAAGAGGCGAACCACCTT
TTAGGCGATATTATAAAGGCTACGCCAACGTCTAAAGCGGTGGGAGACTTGGCTCAGTTCATGGTCGACCGCAAG
CTTTCCGCGTCACAAGTACAGGAACGTGCTTCAACTCTGGACTTTCCAAGATCTGTCATCGAATATTTCGAGGGT
TTAATGGGCCAGCCGTTCGATGGCTTCCCAGAGCCATTCCGGACCAACGTCCTCCGAGGCCGCGACAGCGATATA
AGGAGTAGGCCCGGTTTAACGATGGTGCCAATCGACTTTGACCGCGTTCGACGAGAGATAAAGGAGAAGTATCCA
GAGAGACCGGTAACAGAAGACGATATTGCCAGCTATGTCATGTATCCGGAAGTATATATGGACTACCGACAGGCA
CGGCGGGATTTCGGCGATCTCACGGCACTGCGGACGCCCGACTTTCTTTCTCCGCCGGAGGTCGGTCAAGAAGTA
CAAATGAAAATCGACGAAAGAGAATTTATTATGGAGATGATAGCAATTCGGCCTCCAGAAGTTACGACTGGAAAG
TGTGAGGTTTTTTTCCGGCTCAATGGCCAAGTCTGTTCGGTGGTCGTGCAGGACGATAAGGGTAAGTGA
Gene >Hirsu2|9807
ATGACTTGGCGTCATGTCACAGAGAACGCGGGTACAGTGGAGTTTCTCGTTGAGAATGAGGAATTCTACTTCATC
GAGATGAACCCTCGGATGTACGTCGACCCTAGGCCTTGAGCCAAGGCCCGAGGCTGAGAGAATATAACGTGTCAA
CTGAAAAGCCATCTACAGACAGGTTGAGCATACCATTACTGAGGAAATAACTGGGATCGACATAGTGTCTGCGCA
ATTACGGATTGCTCGAGGGGCGACGCTGGCCGAGCTAGGATTAGAGCAGGACAAGATTGAGGTCAAAGGATACGC
AATTCAGTGTCGTGTCACGACTGAAATCCCTTCGCAGGGATTCCGTCCGGATACTGGCACAATCGGGGGATGTTG
CTTGCCGGTTGGCAGGGGTGTCCGACTTGACCATAGCGACTGCTTTCTTGGGGCGCGAATCAGCCCCTTCTACGA
CTCGCTTCTGGTCAAGTGCATCTGTTCTGGCCCCGACATAAATTCTACCATAAGAAGAGCGACTAGAGCCTTGGG
CGAGTTCGATATTCGAGGGATTCAAACTAACATCGAATTTCTAATCCGCCTTCTTGCACATGAGACCTTTGCTGC
AGGCGACTGCTGGACGTCATTCATCGATGACGCCCCGGATATACTGCCTTCGCACACGTACCATGACGAGGCTCA
GGGATTAATGCGGTTTCTGGCCGATGCTGCCGTCAACGGCAGTCGCATTCAGGGACAAGTGGTAAAATAACCCAT
GATCACGTTTCATGAACCGCCCCGATCAGTCGGTCTCTCTGACAGAAGATTCCATGTCCAGAAAGAGCCCGCATT
AAAGAGAGACATCGAAATTGGACGCATGGTCAACCCAAAGTCAGGCGAAGAGGTCAATACCGCCGAGCCCTGTCA
TTGGGGATGGCGGAACATACTTCTTCGACATGGGCCGCGCGAGTTCGCCCGTCAGATCCGGGCTCATGGTAGAGC
GCTGATCACTGACACCACCTGGCGAGACGGGCAGCAATCCCTTCTGGCGACCCGGGTGCGGAGCAGAGACTTGGA
GGCGATAGCTATGCACACAAGTCACGCGTACCGCGAGGCATACAGTCTCGAGAGTTGGGGTGGCGCCACATTTGA
CGTTATGCTCCGATTCCTGTACGAGGATCCTTGGCAGCGTCTTGTACGTTGCCCCCGATTATTTTGCCTCTTCCC
GAGTATACCAGTCTCACTTGAGGCCCAAGCCCATGAAAGATTGATATTGATAGACAATCGATCGCATAGCGGAAG
CTTCGAAAGCTCGTACCGTACGCTCGGTCAAGCCCTTTTCCATCGAACGATGACGAGACGAACTCGGCTAATATT
TTCGGCACTTAATAGAAATATTCCATTTCAAATGCTGTTGAGGAGCACAAATGGGGTTGCGTACTCCGCGTGAGC
CAGCTTTGCCCCCTCGCATTCCGATGTGAGGCCGACTCTGACTGACTGGCGCTAGATTGCCTGATAATGCTCTCT
TCCACTTTGTCAAGCAAGCAAAGGATGCGGGTATTGACATATTTCGAGTTTTCGATAGCCTGAACGACCTAGAAA
ACCTCAAAACAGGCATCGACGCTGTTCAAGCGGCTGGAGGCTTGGTCGAGGGAGCCATCATGTACACCGGCGACA
TGCTTGAGTTCGGCACAAAATACAACCTTGACTACTATATGAGAATTGTGGACCATCTAGTCGACTTTGGATCAC
ATGTCATTGCAGTTAAGTCTATGTCGGGAGTTATGAAGCCGGCAGCAGGTCGAGCACTAGTGCGAGCCATTCGAG
CTAAATACCCCGATATGCCTCTTCATATGCACACTCACGATACGAACGGGGCCGGCACCGCGACAATGGTTGCTT
GCGTTGAAGAAGGCGCAGACATTGTCGATACGGCCATAGATAGCATGTCCGGATCAACGTCTCAGCCTGCGGCCA
GTGCTGTTATTGCCTCGCTGGAAAATACGGGCTTCGATTCAGCCCTATCTCTAGACCAAATACGAGTAATCGATT
CATATTGGGCTCAGCTTCGACTGGTTTACGCGGGGTTCGACGCTGACTTGCGATCGCCCGACCCCACCATCTACA
AACACGAGATTCCGGGCGGCCAGTATTCAAATCTTCTGTTTCAGGCGCGCCAAAATGGGTTGGGCAACCAATGGG
CAGATACCCTGAAGGCGTACGAAGAGGCGAACCACCTTTTAGGCGATATTATAAAGGCTACGCCAACGTCTAAAG
CGGTGGGAGACTTGGCTCAGTTCATGGTCGACCGCAAGCTTTCCGCGTCACAAGTACAGGAACGTGCTTCAACTC
TGGACTTTCCAAGATCTGTCATCGAATATTTCGAGGGTTTAATGGGCCAGCCGTTCGATGGCTTCCCAGAGCCAT
TCCGGACCAACGTCCTCCGAGGCCGCGACAGCGATATAAGGAGTAGGCCCGGTTTAACGATGGTGCCAATCGACT
TTGACCGCGTTCGACGAGAGATAAAGGAGAAGTATCCAGAGAGACCGGTAACAGAAGACGATATTGCCAGCTATG
TCATGTATCCGGAAGTATATATGGACTACCGACAGGCACGGCGGGATTTCGGCGATCTCACGGCACTGCGGACGC
CCGACTTTCTTTCTCCGCCGGAGGTCGGTCAAGAAGTACAAATGAAAATCGACGAAAGAGAATTTATTATGGAGA
TGATAGCAATTCGGCCTCCAGAAGTTACGACTGGAAAGTGTGAGGTTTTTTTCCGGCTCAATGGCCAAGTCTGTT
CGGTGGTCGTGCAGGACGATAAGGGTAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail