Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9802
Gene name
LocationContig_74:24115..25486
Strand+
Gene length (bp)1371
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 2.1E-54 4 368
PF00324 AA_permease Amino acid permease 5.0E-19 2 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 3 385 1.0E-52
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 4 392 1.0E-45
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 3 392 3.0E-37
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 3 392 2.0E-36
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 89 373 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 3 385 1.0E-52
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 4 392 1.0E-45
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 3 392 3.0E-37
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 3 392 2.0E-36
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 89 373 3.0E-34
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 3 403 5.0E-34
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 68 399 2.0E-32
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 4 379 6.0E-32
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 3 404 2.0E-31
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 3 367 1.0E-28
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 5 379 4.0E-28
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 3 399 3.0E-25
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 3 400 6.0E-25
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 4 407 3.0E-24
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 112 401 1.0E-19
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 108 375 5.0E-14
sp|P0AA47|PLAP_ECOLI Low-affinity putrescine importer PlaP OS=Escherichia coli (strain K12) GN=plaP PE=1 SV=1 114 265 4.0E-09
sp|P0AA48|PLAP_ECO57 Low-affinity putrescine importer PlaP OS=Escherichia coli O157:H7 GN=plaP PE=3 SV=1 114 265 4.0E-09
sp|P76037|PUUP_ECOLI Putrescine importer PuuP OS=Escherichia coli (strain K12) GN=puuP PE=1 SV=2 130 339 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 49 66 17
3 73 95 22
4 119 141 22
5 154 176 22
6 206 228 22
7 257 276 19
8 286 308 22
9 321 343 22
10 358 380 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9802
MSASYFTGWISVGGQIVFTASAAFATGLQAQALITLNDDTYSPQRWQGMLFYWAILVYAGVMNIWGSKTLPHVNL
ASGFIHIAGFVGIVATLAAMAKKNTAAFVFTEFVNSSGWDSDAVSWLVGLLSAVFPFLGYDAACHLAEELPDASR
NVPLAMLGSVVINGLMGFAYCILLLFSASSLDRLTHTPTGFPFMQIYLDATKSRAGATVMSLMLVLVAAAATVAS
VTSTSRTLWAFARDRGTPYHEYLSHVHPKLQVPVRAIVLVLVPQLLLGLLYLGNDTAFNAALAMAIIGLYLSYIL
PIAYMLFNGRQNLKKKDFGPFRLGPILGIICNVISMIWMIVAMIFSTFPSQMPVTPQTMNYSIVVLAGWILFGAI
YYFVVARHKFVVPMTDVRVIPDSSESVVGGDKG*
Coding >Hirsu2|9802
ATGTCGGCCTCATACTTCACCGGCTGGATCTCAGTCGGTGGCCAGATCGTGTTTACAGCCTCCGCTGCGTTCGCC
ACAGGTCTCCAAGCGCAGGCACTGATCACTTTGAACGATGACACATATTCTCCCCAGCGATGGCAGGGAATGCTC
TTCTACTGGGCCATCCTAGTCTATGCCGGCGTCATGAATATTTGGGGCTCGAAAACCCTGCCGCATGTGAATCTC
GCCTCGGGCTTCATTCACATTGCCGGATTTGTTGGAATAGTGGCAACGCTGGCTGCCATGGCTAAGAAGAACACG
GCGGCTTTCGTTTTTACAGAGTTTGTGAACAGCAGCGGCTGGGATTCAGATGCTGTTTCATGGCTGGTCGGTCTT
CTGAGCGCCGTCTTCCCTTTCCTTGGCTATGATGCGGCCTGCCACTTGGCTGAAGAGCTGCCCGACGCCAGCCGA
AACGTTCCCTTGGCCATGCTTGGCAGCGTCGTCATCAATGGTCTAATGGGATTCGCGTATTGTATCTTGCTCCTG
TTCTCTGCAAGCTCCCTGGATCGGTTGACTCATACACCCACCGGCTTTCCCTTCATGCAGATCTACCTCGATGCC
ACCAAATCTCGCGCGGGAGCGACAGTCATGTCCTTGATGCTGGTTTTGGTTGCCGCGGCTGCAACTGTTGCTAGC
GTCACCTCTACTTCTCGGACGCTCTGGGCGTTCGCTCGCGACCGGGGCACACCATACCATGAGTATTTAAGCCAT
GTTCATCCGAAACTGCAGGTCCCTGTTCGAGCCATCGTGCTGGTGTTGGTTCCGCAACTGCTTCTCGGACTCCTA
TACTTGGGTAACGATACCGCTTTCAACGCCGCCCTTGCAATGGCCATTATTGGTCTCTATCTGTCTTACATCCTA
CCGATTGCCTACATGCTGTTCAACGGACGCCAAAATTTGAAGAAGAAAGATTTCGGGCCCTTCCGACTTGGTCCC
ATTCTAGGCATCATCTGCAATGTCATAAGTATGATATGGATGATTGTCGCCATGATCTTCAGCACGTTTCCGAGC
CAGATGCCAGTTACTCCTCAGACGATGAACTATTCCATCGTCGTACTGGCTGGCTGGATATTGTTTGGAGCTATC
TACTACTTTGTGGTAGCAAGGCACAAATTCGTGGTCCCTATGACGGACGTCAGAGTTATCCCTGACTCATCTGAA
TCGGTGGTTGGTGGCGATAAGGGCTGA
Transcript >Hirsu2|9802
ATGTCGGCCTCATACTTCACCGGCTGGATCTCAGTCGGTGGCCAGATCGTGTTTACAGCCTCCGCTGCGTTCGCC
ACAGGTCTCCAAGCGCAGGCACTGATCACTTTGAACGATGACACATATTCTCCCCAGCGATGGCAGGGAATGCTC
TTCTACTGGGCCATCCTAGTCTATGCCGGCGTCATGAATATTTGGGGCTCGAAAACCCTGCCGCATGTGAATCTC
GCCTCGGGCTTCATTCACATTGCCGGATTTGTTGGAATAGTGGCAACGCTGGCTGCCATGGCTAAGAAGAACACG
GCGGCTTTCGTTTTTACAGAGTTTGTGAACAGCAGCGGCTGGGATTCAGATGCTGTTTCATGGCTGGTCGGTCTT
CTGAGCGCCGTCTTCCCTTTCCTTGGCTATGATGCGGCCTGCCACTTGGCTGAAGAGCTGCCCGACGCCAGCCGA
AACGTTCCCTTGGCCATGCTTGGCAGCGTCGTCATCAATGGTCTAATGGGATTCGCGTATTGTATCTTGCTCCTG
TTCTCTGCAAGCTCCCTGGATCGGTTGACTCATACACCCACCGGCTTTCCCTTCATGCAGATCTACCTCGATGCC
ACCAAATCTCGCGCGGGAGCGACAGTCATGTCCTTGATGCTGGTTTTGGTTGCCGCGGCTGCAACTGTTGCTAGC
GTCACCTCTACTTCTCGGACGCTCTGGGCGTTCGCTCGCGACCGGGGCACACCATACCATGAGTATTTAAGCCAT
GTTCATCCGAAACTGCAGGTCCCTGTTCGAGCCATCGTGCTGGTGTTGGTTCCGCAACTGCTTCTCGGACTCCTA
TACTTGGGTAACGATACCGCTTTCAACGCCGCCCTTGCAATGGCCATTATTGGTCTCTATCTGTCTTACATCCTA
CCGATTGCCTACATGCTGTTCAACGGACGCCAAAATTTGAAGAAGAAAGATTTCGGGCCCTTCCGACTTGGTCCC
ATTCTAGGCATCATCTGCAATGTCATAAGTATGATATGGATGATTGTCGCCATGATCTTCAGCACGTTTCCGAGC
CAGATGCCAGTTACTCCTCAGACGATGAACTATTCCATCGTCGTACTGGCTGGCTGGATATTGTTTGGAGCTATC
TACTACTTTGTGGTAGCAAGGCACAAATTCGTGGTCCCTATGACGGACGTCAGAGTTATCCCTGACTCATCTGAA
TCGGTGGTTGGTGGCGATAAGGGCTGA
Gene >Hirsu2|9802
ATGTCGGCCTCATACTTCACCGGCTGGATCTCAGTCGGTGGCCAGATCGTGTTTACAGCCTCCGCTGCGTTCGCC
ACAGGTCTCCAAGCGCAGGCACTGATCACTTTGAACGATGACACATATTCTCCCCAGCGATGGCAGGGAATGCTC
TTCTACTGGGCCATCCTAGTCTATGCCGGCGTCATGAATATTTGGGGCTCGAAAACCCTGCCGCATGTGAATCTC
GCCTCGGGTAAGGAGATCATACCACGCGCCATGCACCCCTAAGTGAATTCTAAGACAGACTGGTCTCCTAGGCTT
CATTCACATTGCCGGATTTGTTGGAATAGTGGCAACGCTGGCTGCCATGGCTAAGAAGAACACGGCGGCTTTCGT
TTTTACAGAGTTTGTGAACAGCAGCGGCTGGGATTCAGATGCTGTTTCATGGCTGGTCGGTCTTCTGAGCGCCGT
CTTCCCTTTCCTTGGGTAAGTCCACTGGAAGCTGCCTCGAACAATGGTCGTCACTGGGTATGTTCAGTCGACTGA
AGCCATCAACTCTGTCGCAGCTATGATGCGGCCTGCCACTTGGCTGAAGAGCTGCCCGACGCCAGCCGAAACGTT
CCCTTGGCCATGCTTGGCAGCGTCGTCATCAATGGTCTAATGGGATTCGCGTATTGTATCTTGCTCCTGTTCTCT
GCAAGCTCCCTGGATCGGTTGACTCATACACCCACCGGCTTTCCCTTCATGCAGATCTACCTCGATGCCACCAAA
TCTCGCGCGGGAGCGACAGTCATGTCCTTGATGCTGGTTTTGGTTGCCGCGGCTGCAACTGTTGCTAGCGTCACC
TCTACTTCTCGGACGCTCTGGGCGTTCGCTCGCGACCGGGGCACACCATACCATGAGTATTTAAGCCATGTTCAT
CCGAAACTGCAGGTCCCTGTTCGAGCCATCGTGCTGGTGTTGGTTCCGCAACTGCTTCTCGGACTCCTATACTTG
GGTAACGATACCGCTTTCAACGCCGCCCTTGCAATGGCCATTATTGGTCTCTATCTGTCTTACATCCTACCGATT
GCCTACATGCTGTTCAACGGACGCCAAAATTTGAAGAAGAAAGATTTCGGGCCCTTCCGACTTGGTCCCATTCTA
GGCATCATCTGCAATGTCATAAGTATGATATGGATGATTGTCGCCATGATCTTCAGCACGTTTCCGAGCCAGATG
CCAGTTACTCCTCAGACGATGAACTATTCCATCGTCGTACTGGCTGGCTGGATATTGTTTGGAGCTATCTACTAC
TTTGTGGTAGCAAGGCACAAATTCGTGGTCCCTATGACGGACGTCAGAGTTATCCCTGACTCATCTGAATCGGTG
GTTGGTGGCGATAAGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail