Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9794
Gene name
LocationContig_74:445..2143
Strand+
Gene length (bp)1698
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 50 67 17
3 82 104 22
4 124 146 22
5 169 191 22
6 203 220 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9794
MWYVGGIEIVDGNHGLVVSGFLFTSLSCLAVWLRIFTRSVLVRNIGLDDYFICAAMLGTIAFWTAVLQQVRYGLG
DEVNPAILQQFLQSLLATIIAYSFTHLSVKFSIVLQCKRIFTEKSAQRVFFILILWLTVYGLFCFLSSIVTCVPI
AKYWDDSIPGGCIDRSNLHYALAGFNIVNDVALLIAPIPYLRNLQIPRRAKFVLIAVFACGVKGVDIAIWSGLEI
NIAIICASVPALKPLFVKFFPQLISSLGDSAKRSRSGRSAHGSMPHRGSENRTQQSGDHDSKTCPLEIQVQQSFE
MKAVAPERDDDSEKNLVPRNAATWTAECYAGPRHQRSRPSQLEVCRESEWT*
Coding >Hirsu2|9794
ATGTGGTACGTCGGTGGCATCGAAATTGTGGATGGGAATCACGGCCTTGTCGTTTCCGGCTTCCTCTTCACAAGC
CTTTCCTGTTTGGCTGTCTGGCTTCGAATATTCACCCGCTCCGTCCTCGTGCGAAACATCGGTCTCGATGATTAC
TTCATCTGTGCTGCCATGCTCGGGACCATCGCCTTCTGGACAGCAGTGCTGCAGCAGGTCCGATACGGTCTCGGA
GACGAGGTCAATCCAGCTATCCTCCAGCAGTTCCTTCAGTCCCTCCTCGCAACTATTATCGCCTACAGCTTCACT
CATCTGTCGGTCAAGTTCTCGATCGTACTGCAGTGCAAGCGAATTTTCACCGAGAAAAGCGCCCAGCGCGTCTTC
TTCATCCTCATCCTCTGGTTGACCGTGTACGGTCTCTTCTGCTTCCTCAGCTCCATCGTCACATGTGTCCCTATC
GCCAAATATTGGGACGATAGCATTCCCGGCGGCTGCATCGATCGCTCGAATCTGCACTATGCTCTCGCTGGTTTT
AACATCGTCAATGACGTTGCTCTCCTTATCGCGCCCATTCCATATCTCAGGAACCTGCAGATTCCGCGGAGGGCC
AAGTTCGTGCTAATCGCAGTGTTTGCCTGCGGTGTCAAGGGAGTGGACATCGCAATTTGGTCCGGGCTCGAAATC
AACATAGCCATCATTTGTGCCTCTGTCCCAGCTCTCAAGCCCTTATTCGTCAAATTCTTCCCCCAACTCATCAGC
TCCCTAGGCGACTCGGCAAAACGGTCGAGATCCGGTCGCTCGGCCCACGGCAGCATGCCGCATCGGGGTTCGGAA
AACCGCACACAGCAGAGCGGCGACCACGACTCCAAGACTTGTCCGCTCGAAATCCAGGTCCAACAGTCATTCGAG
ATGAAGGCAGTGGCCCCCGAGCGAGACGACGATAGCGAGAAGAACCTGGTTCCGAGAAACGCGGCGACGTGGACG
GCCGAGTGTTACGCCGGGCCGCGACACCAGCGTTCCAGACCCTCGCAGCTGGAAGTATGTAGAGAAAGTGAATGG
ACATAA
Transcript >Hirsu2|9794
ATGTGGTACGTCGGTGGCATCGAAATTGTGGATGGGAATCACGGCCTTGTCGTTTCCGGCTTCCTCTTCACAAGC
CTTTCCTGTTTGGCTGTCTGGCTTCGAATATTCACCCGCTCCGTCCTCGTGCGAAACATCGGTCTCGATGATTAC
TTCATCTGTGCTGCCATGCTCGGGACCATCGCCTTCTGGACAGCAGTGCTGCAGCAGGTCCGATACGGTCTCGGA
GACGAGGTCAATCCAGCTATCCTCCAGCAGTTCCTTCAGTCCCTCCTCGCAACTATTATCGCCTACAGCTTCACT
CATCTGTCGGTCAAGTTCTCGATCGTACTGCAGTGCAAGCGAATTTTCACCGAGAAAAGCGCCCAGCGCGTCTTC
TTCATCCTCATCCTCTGGTTGACCGTGTACGGTCTCTTCTGCTTCCTCAGCTCCATCGTCACATGTGTCCCTATC
GCCAAATATTGGGACGATAGCATTCCCGGCGGCTGCATCGATCGCTCGAATCTGCACTATGCTCTCGCTGGTTTT
AACATCGTCAATGACGTTGCTCTCCTTATCGCGCCCATTCCATATCTCAGGAACCTGCAGATTCCGCGGAGGGCC
AAGTTCGTGCTAATCGCAGTGTTTGCCTGCGGTGTCAAGGGAGTGGACATCGCAATTTGGTCCGGGCTCGAAATC
AACATAGCCATCATTTGTGCCTCTGTCCCAGCTCTCAAGCCCTTATTCGTCAAATTCTTCCCCCAACTCATCAGC
TCCCTAGGCGACTCGGCAAAACGGTCGAGATCCGGTCGCTCGGCCCACGGCAGCATGCCGCATCGGGGTTCGGAA
AACCGCACACAGCAGAGCGGCGACCACGACTCCAAGACTTGTCCGCTCGAAATCCAGGTCCAACAGTCATTCGAG
ATGAAGGCAGTGGCCCCCGAGCGAGACGACGATAGCGAGAAGAACCTGGTTCCGAGAAACGCGGCGACGTGGACG
GCCGAGTGTTACGCCGGGCCGCGACACCAGCGTTCCAGACCCTCGCAGCTGGAAGTATGTAGAGAAAGTGAATGG
ACATAA
Gene >Hirsu2|9794
ATGTGGTACGTCGGTGGCATCGAAATTGTGGATGGGAATCACGGCCTTGTCGTTTCCGGCTTCCTCTTCACAAGC
CTTTCCTGTTTGGCTGTCTGGCTTCGAATATTCACCCGCTCCGTCCTCGTGCGAAACATCGGTCTCGATGATTAC
TTCATCTGTGCTGCCATGGTAAGAGACATTGAACTTGAAGCATTCGTCCAGTCGCCTCAGCCAACCGTCTCCCGA
TCATCGACGGCATGAGGCGTGGCCAGGAACTTCCCAGCACGAAGTCGGCGATTTCCCCTTTCGAGGCCTCTGACT
TCTATTCGTCTATACTGAAGGAGGCGGCTGGATGCTAACGACACTTGAACTGCACGCGCGAAGCTCGGGACCATC
GCCTTCTGGACAGCAGTGCTGCAGCGTAAGCCAATCTCCCAACCTGTTCCGCGGTGACCATTGCCCTGTCGCGCT
TTTAAACTGTTTTCACTTTCTTCATCTTACGATTCGTCTCTAATTGCATCATACGCAGAGGTCCGATACGGTCTC
GGAGACGAGGTCAATCCAGCTATCCTCCAGCAGTTCCTTCAGTCCCTCCTCGCAACTATTATCGCCTACAGCTTC
ACTCATCTGTCGGTCAAGTTCTCGATCGTACTGCAGTGCAAGCGAATTTTCACCGAGAAAAGCGCCCAGCGCGTC
TTCTTCATCCTCATCCTCTGGTTGACCGTGTAGTAAGTTGATGACGGGTCACTCCCTTTGCTACATCCAACTCAA
CAACTCGCTTGCGGGCGATACAGCGGTCTCTTCTGCTTCCTCAGCTCCATCGTCACATGTGTCCCTATCGCCAAA
TATTGGGACGATAGCATTCCCGGCGGCTGCATCGATCGCTCGAATCTGCACTATGCTCTCGCTGGTTTTAACATC
GTCAATGACGTTGCTCTCCTTATCGCGCCCATTCCATATCTCAGGAACCTGCAGATTCCGCGGAGGGCCAAGTTC
GTGCTAATCGCAGTGTTTGCCTGCGGTGGTTTGTGCGTTCCCATTTCGACCGAGCCTCTCGTTCATGAATATACT
GACATTTATCTGTGGTGCCTTGAATCACAGTGCCTGCATCGTTGCCATTATTCGATTACACTCATTATATGTCAA
CAACTCGGCTCCCATCGACCAACAGCCAAGTAAGTCGCCATTTCCGCAGTCCCGGCCTACACGAGGAGCACAGCT
GTTCTGTTGCACGCATCGAGTTGGAGGCTGTTATGTATCTATGTCCGCTGACGTCATTGATTACCTTCTTCACCA
GTCAAGGGAGTGGACATCGCAATTTGGTCCGGGCTCGAAATCAACATAGCCATCATTTGTGCCTCTGTCCCAGCT
CTCAAGCCCTTATTCGTCAAATTCTTCCCCCAACTCATCAGCTCCCTAGGCGACTCGGCAAAACGGTCGAGATCC
GGTCGCTCGGCCCACGGCAGCATGCCGCATCGGGGTTCGGAAAACCGCACACAGCAGAGCGGCGACCACGACTCC
AAGACTTGTCCGCTCGAAATCCAGGTCCAACAGTCATTCGAGATGAAGGCAGTGGCCCCCGAGCGAGACGACGAT
AGCGAGAAGAACCTGGTTCCGAGAAACGCGGCGACGTGGACGGCCGAGTGTTACGCCGGGCCGCGACACCAGCGT
TCCAGACCCTCGCAGCTGGAAGTATGTAGAGAAAGTGAATGGACATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail