Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9785
Gene name
LocationContig_738:8972..11636
Strand+
Gene length (bp)2664
Transcript length (bp)2415
Coding sequence length (bp)2415
Protein length (aa) 805

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.3E-02 465 488
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.7E-04 494 516

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14258|ACE2_SCHPO Metallothionein expression activator OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ace2 PE=3 SV=1 448 550 2.0E-29
sp|Q59RR0|ACE2_CANAL Cell wall transcription factor ACE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACE2 PE=3 SV=1 449 585 8.0E-26
sp|P08153|SWI5_YEAST Transcriptional factor SWI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI5 PE=1 SV=1 431 565 1.0E-25
sp|P21192|ACE2_YEAST Metallothionein expression activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACE2 PE=1 SV=1 439 548 7.0E-23
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 462 560 9.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14258|ACE2_SCHPO Metallothionein expression activator OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ace2 PE=3 SV=1 448 550 2.0E-29
sp|Q59RR0|ACE2_CANAL Cell wall transcription factor ACE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACE2 PE=3 SV=1 449 585 8.0E-26
sp|P08153|SWI5_YEAST Transcriptional factor SWI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI5 PE=1 SV=1 431 565 1.0E-25
sp|P21192|ACE2_YEAST Metallothionein expression activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACE2 PE=1 SV=1 439 548 7.0E-23
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 462 560 9.0E-22
sp|Q6FJQ9|ACE2_CANGA Cell wall transcription factor ACE2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACE2 PE=3 SV=1 450 564 2.0E-20
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 471 539 5.0E-17
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 471 541 2.0E-15
sp|Q59SN6|CRZ2_CANAL Transcriptional regulator CRZ2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ2 PE=2 SV=1 471 546 4.0E-14
sp|Q8VCZ7|ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus GN=Zbtb7c PE=2 SV=1 471 566 9.0E-14
sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens GN=ZBTB7C PE=2 SV=1 471 566 1.0E-13
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 470 543 1.0E-13
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 459 541 3.0E-13
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 449 562 9.0E-13
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 449 562 1.0E-12
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 471 568 1.0E-12
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 1.0E-12
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 471 542 1.0E-12
sp|Q9Z0G7|ZBT22_MOUSE Zinc finger and BTB domain-containing protein 22 OS=Mus musculus GN=Zbtb22 PE=2 SV=1 471 545 1.0E-12
sp|O15209|ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens GN=ZBTB22 PE=1 SV=1 471 545 1.0E-12
sp|O15156|ZBT7B_HUMAN Zinc finger and BTB domain-containing protein 7B OS=Homo sapiens GN=ZBTB7B PE=1 SV=2 449 546 2.0E-12
sp|Q5TJE2|ZBT22_CANLF Zinc finger and BTB domain-containing protein 22 OS=Canis lupus familiaris GN=ZBTB22 PE=3 SV=1 471 545 2.0E-12
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 454 542 2.0E-12
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 470 539 2.0E-12
sp|O35738|KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus GN=Klf12 PE=1 SV=2 428 546 2.0E-12
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 471 547 2.0E-12
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 459 541 2.0E-12
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 470 541 3.0E-12
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 466 546 3.0E-12
sp|Q64321|ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus GN=Zbtb7b PE=1 SV=2 469 546 3.0E-12
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 454 546 5.0E-12
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 453 540 5.0E-12
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 459 539 5.0E-12
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 454 546 5.0E-12
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 375 540 6.0E-12
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 471 541 6.0E-12
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 464 544 7.0E-12
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 449 539 7.0E-12
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 458 544 7.0E-12
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 458 544 7.0E-12
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 7.0E-12
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 464 539 9.0E-12
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 455 541 9.0E-12
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 389 541 9.0E-12
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 389 541 1.0E-11
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 441 541 1.0E-11
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 469 541 1.0E-11
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 464 541 1.0E-11
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 464 539 1.0E-11
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 471 541 1.0E-11
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 464 541 2.0E-11
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 453 541 2.0E-11
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 453 541 2.0E-11
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 442 541 2.0E-11
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 467 539 2.0E-11
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 470 541 2.0E-11
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 464 541 2.0E-11
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 466 542 3.0E-11
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 469 541 3.0E-11
sp|P18740|ZO14_XENLA Oocyte zinc finger protein XlCOF14 (Fragment) OS=Xenopus laevis PE=3 SV=1 462 539 3.0E-11
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 540 3.0E-11
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 467 539 3.0E-11
sp|Q15697|ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens GN=ZNF174 PE=1 SV=1 469 539 3.0E-11
sp|P18752|ZO72_XENLA Oocyte zinc finger protein XlCOF7.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 440 541 3.0E-11
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 464 541 3.0E-11
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 470 539 3.0E-11
sp|C7EMF5|KLF17_PIG Krueppel-like factor 17 OS=Sus scrofa GN=KLF17 PE=2 SV=1 451 544 3.0E-11
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 459 541 3.0E-11
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 467 539 3.0E-11
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 466 541 3.0E-11
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 469 541 3.0E-11
sp|P57071|PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens GN=PRDM15 PE=2 SV=4 469 549 3.0E-11
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 442 541 3.0E-11
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 464 539 3.0E-11
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 442 541 3.0E-11
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 441 541 4.0E-11
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 464 541 4.0E-11
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 455 541 4.0E-11
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 441 541 4.0E-11
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 466 542 4.0E-11
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 455 541 4.0E-11
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 455 544 4.0E-11
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 461 541 4.0E-11
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 455 544 4.0E-11
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 449 539 4.0E-11
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 455 539 4.0E-11
sp|Q8BLM0|KLF8_MOUSE Krueppel-like factor 8 OS=Mus musculus GN=Klf8 PE=2 SV=1 466 542 4.0E-11
sp|P18740|ZO14_XENLA Oocyte zinc finger protein XlCOF14 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 540 5.0E-11
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 470 541 5.0E-11
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 471 541 5.0E-11
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 470 541 5.0E-11
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 470 540 5.0E-11
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 442 541 5.0E-11
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 441 539 5.0E-11
sp|Q9DAI4|ZBT43_MOUSE Zinc finger and BTB domain-containing protein 43 OS=Mus musculus GN=Zbtb43 PE=2 SV=2 385 539 5.0E-11
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 428 539 5.0E-11
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 461 539 5.0E-11
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 455 539 5.0E-11
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 470 541 5.0E-11
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 541 6.0E-11
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 470 541 6.0E-11
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 470 541 6.0E-11
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 541 6.0E-11
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 470 541 6.0E-11
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 467 541 6.0E-11
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 455 539 6.0E-11
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 455 541 6.0E-11
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 456 569 6.0E-11
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 470 541 6.0E-11
sp|Q9H9D4|ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens GN=ZNF408 PE=1 SV=1 467 541 6.0E-11
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 470 541 6.0E-11
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 7.0E-11
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 470 539 7.0E-11
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 470 541 7.0E-11
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 452 541 7.0E-11
sp|Q5XJQ7|OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio GN=osr1 PE=2 SV=1 416 544 7.0E-11
sp|Q91924|SNAI2_XENLA Zinc finger protein SNAI2 OS=Xenopus laevis GN=snai2 PE=1 SV=1 466 547 7.0E-11
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 7.0E-11
sp|O08954|SNAI2_RAT Zinc finger protein SNAI2 OS=Rattus norvegicus GN=Snai2 PE=2 SV=2 466 547 7.0E-11
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 470 541 8.0E-11
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 463 541 9.0E-11
sp|P18716|ZG28_XENLA Gastrula zinc finger protein XlCGF28.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 465 539 9.0E-11
sp|P18716|ZG28_XENLA Gastrula zinc finger protein XlCGF28.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 539 9.0E-11
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 470 541 9.0E-11
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 469 539 9.0E-11
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 471 541 9.0E-11
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 361 541 9.0E-11
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 469 539 9.0E-11
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 471 539 9.0E-11
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 469 540 9.0E-11
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 470 539 1.0E-10
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 471 541 1.0E-10
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 455 541 1.0E-10
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 452 541 1.0E-10
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 471 539 1.0E-10
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 469 539 1.0E-10
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 470 539 1.0E-10
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 469 539 1.0E-10
sp|P97469|SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus GN=Snai2 PE=1 SV=1 466 547 1.0E-10
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 470 541 1.0E-10
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 470 541 1.0E-10
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 470 541 1.0E-10
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 470 541 1.0E-10
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 470 541 1.0E-10
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 450 541 1.0E-10
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 456 539 1.0E-10
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 540 1.0E-10
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 471 541 1.0E-10
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 442 541 1.0E-10
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 470 541 1.0E-10
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 471 541 1.0E-10
sp|O43298|ZBT43_HUMAN Zinc finger and BTB domain-containing protein 43 OS=Homo sapiens GN=ZBTB43 PE=1 SV=1 385 539 1.0E-10
sp|O43623|SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens GN=SNAI2 PE=1 SV=1 466 547 1.0E-10
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 453 539 1.0E-10
sp|Q3T135|OSR2_BOVIN Protein odd-skipped-related 2 OS=Bos taurus GN=OSR2 PE=2 SV=1 455 544 1.0E-10
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 469 541 1.0E-10
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 471 541 1.0E-10
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 471 541 1.0E-10
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 455 541 1.0E-10
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 447 541 1.0E-10
sp|Q6AY34|OSR2_RAT Protein odd-skipped-related 2 OS=Rattus norvegicus GN=Osr2 PE=2 SV=1 455 544 1.0E-10
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 470 541 1.0E-10
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 471 541 1.0E-10
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 471 541 1.0E-10
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 457 539 1.0E-10
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 540 2.0E-10
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 405 540 2.0E-10
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 450 539 2.0E-10
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 455 540 2.0E-10
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 470 541 2.0E-10
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 540 2.0E-10
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 410 540 2.0E-10
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 439 540 2.0E-10
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 459 541 2.0E-10
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 469 544 2.0E-10
sp|P86413|OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis GN=osr1 PE=2 SV=1 443 540 2.0E-10
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 471 541 2.0E-10
sp|Q66JF8|OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis GN=osr1 PE=2 SV=1 443 540 2.0E-10
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 471 541 2.0E-10
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 455 540 2.0E-10
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 469 541 2.0E-10
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 461 539 2.0E-10
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 455 540 2.0E-10
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 539 2.0E-10
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 464 541 2.0E-10
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 540 2.0E-10
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 459 541 2.0E-10
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 454 539 2.0E-10
sp|B0K011|OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus GN=Osr1 PE=2 SV=1 455 540 2.0E-10
sp|Q9WVG7|OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus GN=Osr1 PE=2 SV=1 455 540 2.0E-10
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 469 541 2.0E-10
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 469 539 2.0E-10
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 455 541 2.0E-10
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 465 541 2.0E-10
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 470 541 2.0E-10
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 470 542 2.0E-10
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 467 539 2.0E-10
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 467 539 2.0E-10
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 470 539 2.0E-10
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 470 540 2.0E-10
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 437 539 2.0E-10
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 466 539 2.0E-10
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 466 539 2.0E-10
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 466 539 2.0E-10
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 458 544 2.0E-10
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 466 539 2.0E-10
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 469 539 3.0E-10
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 470 540 3.0E-10
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 470 540 3.0E-10
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 443 541 3.0E-10
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 443 541 3.0E-10
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 439 540 3.0E-10
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 439 540 3.0E-10
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 470 539 3.0E-10
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 471 539 3.0E-10
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 471 539 3.0E-10
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 469 541 3.0E-10
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 455 541 3.0E-10
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 470 541 3.0E-10
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 465 539 3.0E-10
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 466 541 3.0E-10
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 456 544 3.0E-10
sp|Q9QY31|SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus GN=Snai3 PE=2 SV=1 466 547 3.0E-10
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 466 541 3.0E-10
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 466 539 3.0E-10
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 465 544 3.0E-10
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 458 544 3.0E-10
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 458 544 3.0E-10
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 458 544 3.0E-10
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 470 541 3.0E-10
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 458 544 3.0E-10
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 465 544 3.0E-10
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 469 541 3.0E-10
sp|Q5ZM39|BCL6_CHICK B-cell lymphoma 6 protein homolog OS=Gallus gallus GN=BCL6 PE=2 SV=1 471 539 3.0E-10
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 458 542 3.0E-10
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 458 542 3.0E-10
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 466 539 3.0E-10
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 466 539 3.0E-10
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 467 539 3.0E-10
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 464 541 3.0E-10
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 539 3.0E-10
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 470 541 4.0E-10
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 470 541 4.0E-10
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 342 540 4.0E-10
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 410 540 4.0E-10
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 470 541 4.0E-10
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 459 530 4.0E-10
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 471 541 4.0E-10
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 441 539 4.0E-10
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 467 541 4.0E-10
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 467 541 4.0E-10
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 450 539 4.0E-10
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 441 539 4.0E-10
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 470 539 4.0E-10
sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZAP1 PE=1 SV=1 446 539 4.0E-10
sp|P51502|ZNF80_CHLAE Zinc finger protein 80 OS=Chlorocebus aethiops GN=ZNF80 PE=3 SV=1 469 540 4.0E-10
sp|O95863|SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens GN=SNAI1 PE=1 SV=2 466 548 4.0E-10
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 467 539 4.0E-10
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 458 544 4.0E-10
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 470 539 4.0E-10
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 464 541 4.0E-10
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 471 541 4.0E-10
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 464 541 4.0E-10
sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 455 544 4.0E-10
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 455 541 4.0E-10
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 446 540 4.0E-10
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 441 539 4.0E-10
sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=1 SV=2 455 544 4.0E-10
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 457 539 4.0E-10
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 471 541 4.0E-10
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 469 541 4.0E-10
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 540 5.0E-10
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 442 539 5.0E-10
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 470 540 5.0E-10
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 469 541 5.0E-10
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 470 541 5.0E-10
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 470 541 5.0E-10
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 455 541 5.0E-10
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 469 539 5.0E-10
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 446 540 5.0E-10
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 459 530 5.0E-10
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 457 539 5.0E-10
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 465 544 5.0E-10
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 469 540 5.0E-10
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 452 541 5.0E-10
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 464 541 5.0E-10
sp|Q66K89|E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens GN=E4F1 PE=1 SV=2 471 546 5.0E-10
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 464 541 5.0E-10
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 461 539 5.0E-10
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 469 541 5.0E-10
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 464 541 5.0E-10
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 469 541 5.0E-10
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 464 541 5.0E-10
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 469 541 5.0E-10
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 470 541 6.0E-10
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 442 541 6.0E-10
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 442 541 6.0E-10
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 437 540 6.0E-10
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 471 541 6.0E-10
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 471 541 6.0E-10
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 437 540 6.0E-10
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 450 539 6.0E-10
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 465 544 6.0E-10
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 469 541 6.0E-10
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 464 541 6.0E-10
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 464 539 6.0E-10
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 455 541 6.0E-10
sp|Q9Z1D7|ZSC12_MOUSE Zinc finger and SCAN domain-containing protein 12 OS=Mus musculus GN=Zscan12 PE=2 SV=2 440 540 6.0E-10
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 459 543 6.0E-10
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 471 541 6.0E-10
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 464 541 6.0E-10
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 441 541 6.0E-10
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 450 539 6.0E-10
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 470 541 7.0E-10
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 470 541 7.0E-10
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 469 539 7.0E-10
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 467 541 7.0E-10
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 469 541 7.0E-10
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 470 542 7.0E-10
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 470 541 7.0E-10
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 471 541 7.0E-10
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 419 541 7.0E-10
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 442 541 7.0E-10
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 540 7.0E-10
sp|Q80V63|PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus GN=Prdm4 PE=2 SV=2 471 541 7.0E-10
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 541 7.0E-10
sp|Q567J8|OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio GN=osr2 PE=2 SV=1 455 540 7.0E-10
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 464 544 7.0E-10
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 441 539 8.0E-10
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 470 541 8.0E-10
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 470 541 8.0E-10
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 540 8.0E-10
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 469 539 8.0E-10
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 471 539 8.0E-10
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 469 539 8.0E-10
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 8.0E-10
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 437 540 8.0E-10
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 464 539 8.0E-10
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 465 542 8.0E-10
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 540 8.0E-10
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 459 539 8.0E-10
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 470 539 8.0E-10
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 469 541 8.0E-10
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 464 539 8.0E-10
sp|Q8BI66|ZN526_MOUSE Zinc finger protein 526 OS=Mus musculus GN=Znf526 PE=2 SV=1 471 541 8.0E-10
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 459 545 8.0E-10
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 415 539 8.0E-10
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 541 8.0E-10
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 455 541 8.0E-10
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 467 541 8.0E-10
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 442 541 9.0E-10
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 470 541 9.0E-10
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 469 540 9.0E-10
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 470 541 9.0E-10
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 459 530 9.0E-10
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 452 541 9.0E-10
sp|Q9QZP2|PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus GN=Prdm4 PE=2 SV=1 471 541 9.0E-10
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 452 539 9.0E-10
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 469 541 9.0E-10
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 464 541 9.0E-10
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 455 541 9.0E-10
sp|Q02526|ZFP41_MOUSE Zinc finger protein 41 OS=Mus musculus GN=Zfp41 PE=2 SV=2 442 542 9.0E-10
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 467 539 9.0E-10
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 441 539 9.0E-10
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 442 541 9.0E-10
sp|A6QR00|ZN526_BOVIN Zinc finger protein 526 OS=Bos taurus GN=ZNF526 PE=2 SV=1 471 541 9.0E-10
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 467 541 9.0E-10
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 451 541 9.0E-10
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 469 543 9.0E-10
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 470 541 9.0E-10
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 467 541 9.0E-10
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 1.0E-09
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 470 541 1.0E-09
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 460 541 1.0E-09
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 470 540 1.0E-09
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 470 541 1.0E-09
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 470 540 1.0E-09
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 470 541 1.0E-09
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 469 541 1.0E-09
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 470 552 1.0E-09
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 469 541 1.0E-09
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 445 540 1.0E-09
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 404 541 1.0E-09
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 1.0E-09
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 1.0E-09
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 442 541 1.0E-09
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 469 541 1.0E-09
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 471 541 1.0E-09
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 471 541 1.0E-09
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 466 542 1.0E-09
sp|Q9UFB7|ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens GN=ZBTB47 PE=2 SV=3 467 542 1.0E-09
sp|Q9UK12|ZN222_HUMAN Zinc finger protein 222 OS=Homo sapiens GN=ZNF222 PE=2 SV=2 469 569 1.0E-09
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 470 541 1.0E-09
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 470 541 1.0E-09
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 466 542 1.0E-09
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 470 541 1.0E-09
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 464 541 1.0E-09
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 466 542 1.0E-09
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 442 539 1.0E-09
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 470 539 1.0E-09
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 437 540 1.0E-09
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 540 1.0E-09
sp|Q5EXX3|ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus GN=Zbtb38 PE=2 SV=1 467 565 1.0E-09
sp|Q8N143|BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens GN=BCL6B PE=2 SV=2 455 539 1.0E-09
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 541 1.0E-09
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 467 541 1.0E-09
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 470 539 1.0E-09
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 470 541 1.0E-09
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 470 541 1.0E-09
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 464 539 1.0E-09
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 464 561 1.0E-09
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 471 541 1.0E-09
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 441 541 1.0E-09
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 469 541 1.0E-09
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 469 541 1.0E-09
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 470 541 1.0E-09
sp|Q5RJ54|ZSC26_MOUSE Zinc finger and SCAN domain-containing protein 26 OS=Mus musculus GN=Zscan26 PE=2 SV=1 469 541 1.0E-09
sp|O88282|BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus GN=Bcl6b PE=1 SV=1 455 539 1.0E-09
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 441 539 1.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 464 545 1.0E-09
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 469 541 1.0E-09
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 469 540 1.0E-09
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 467 539 1.0E-09
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 411 539 1.0E-09
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 469 541 1.0E-09
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 471 541 1.0E-09
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 471 541 1.0E-09
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 471 541 1.0E-09
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 465 544 1.0E-09
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 471 541 1.0E-09
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 467 549 1.0E-09
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 470 541 1.0E-09
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 469 540 1.0E-09
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 465 542 1.0E-09
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 442 539 1.0E-09
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 471 541 1.0E-09
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 469 541 1.0E-09
sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 471 545 1.0E-09
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 464 561 1.0E-09
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 470 541 1.0E-09
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 466 541 1.0E-09
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 470 542 1.0E-09
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 469 540 1.0E-09
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 470 541 1.0E-09
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 543 1.0E-09
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 442 541 1.0E-09
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 445 550 1.0E-09
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 452 541 1.0E-09
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 470 542 1.0E-09
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 453 541 1.0E-09
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 470 539 1.0E-09
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 469 525 1.0E-09
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 470 542 1.0E-09
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 467 541 1.0E-09
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 470 540 2.0E-09
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 470 541 2.0E-09
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 442 539 2.0E-09
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 470 539 2.0E-09
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 470 541 2.0E-09
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 454 539 2.0E-09
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 442 545 2.0E-09
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 470 541 2.0E-09
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 470 541 2.0E-09
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 470 540 2.0E-09
sp|Q9Z1D7|ZSC12_MOUSE Zinc finger and SCAN domain-containing protein 12 OS=Mus musculus GN=Zscan12 PE=2 SV=2 470 541 2.0E-09
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 469 541 2.0E-09
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 469 539 2.0E-09
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 470 539 2.0E-09
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 470 539 2.0E-09
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 469 545 2.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 442 544 2.0E-09
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 470 541 2.0E-09
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 470 541 2.0E-09
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 441 541 2.0E-09
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 469 541 2.0E-09
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 470 542 2.0E-09
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 470 541 2.0E-09
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 450 540 2.0E-09
sp|Q9H4T2|ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens GN=ZSCAN16 PE=1 SV=2 469 541 2.0E-09
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 470 542 2.0E-09
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 470 542 2.0E-09
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 466 542 2.0E-09
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 470 541 2.0E-09
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 470 541 2.0E-09
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 469 540 2.0E-09
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 470 539 2.0E-09
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 470 541 2.0E-09
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 469 541 2.0E-09
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 442 541 2.0E-09
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 470 541 2.0E-09
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 467 539 2.0E-09
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 471 539 2.0E-09
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 541 2.0E-09
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 439 539 2.0E-09
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 453 541 2.0E-09
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 467 548 2.0E-09
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 455 539 2.0E-09
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 441 541 2.0E-09
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 467 548 2.0E-09
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 469 541 2.0E-09
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 469 541 2.0E-09
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 470 541 2.0E-09
sp|Q811F1|ZBT41_MOUSE Zinc finger and BTB domain-containing protein 41 OS=Mus musculus GN=Zbtb41 PE=2 SV=4 471 539 2.0E-09
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 470 541 2.0E-09
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 470 541 2.0E-09
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 470 541 2.0E-09
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 452 541 2.0E-09
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 450 541 2.0E-09
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 470 539 2.0E-09
sp|Q6P2A1|PRDM9_DANRE Histone-lysine N-methyltransferase PRDM9 OS=Danio rerio GN=prdm9 PE=2 SV=1 467 542 2.0E-09
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 469 541 2.0E-09
sp|A6QNZ0|ZSC26_BOVIN Zinc finger and SCAN domain-containing protein 26 OS=Bos taurus GN=ZSCAN26 PE=2 SV=1 470 540 2.0E-09
sp|Q8NAP3|ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens GN=ZBTB38 PE=1 SV=2 469 565 2.0E-09
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 440 542 2.0E-09
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 464 541 2.0E-09
sp|P41995|ODD1_CAEEL Zinc finger protein odd-1 OS=Caenorhabditis elegans GN=odd-1 PE=2 SV=2 471 540 2.0E-09
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 459 541 2.0E-09
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 415 539 2.0E-09
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 470 539 2.0E-09
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 449 541 2.0E-09
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 459 541 2.0E-09
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 469 541 2.0E-09
sp|Q5SVQ8|ZBT41_HUMAN Zinc finger and BTB domain-containing protein 41 OS=Homo sapiens GN=ZBTB41 PE=1 SV=1 471 539 2.0E-09
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 447 539 2.0E-09
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 464 541 2.0E-09
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 418 541 2.0E-09
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 471 539 2.0E-09
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 442 544 2.0E-09
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 459 541 2.0E-09
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 470 541 2.0E-09
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 469 541 2.0E-09
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 470 541 2.0E-09
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 449 539 2.0E-09
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 471 542 2.0E-09
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 455 545 3.0E-09
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 470 540 3.0E-09
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 471 541 3.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 409 540 3.0E-09
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 470 541 3.0E-09
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 441 544 3.0E-09
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 410 540 3.0E-09
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 470 541 3.0E-09
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 469 540 3.0E-09
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 469 539 3.0E-09
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 441 541 3.0E-09
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 467 541 3.0E-09
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 469 541 3.0E-09
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 540 3.0E-09
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 469 541 3.0E-09
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 470 541 3.0E-09
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 470 541 3.0E-09
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 466 541 3.0E-09
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 459 541 3.0E-09
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 470 541 3.0E-09
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 470 540 3.0E-09
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 471 540 3.0E-09
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 470 540 3.0E-09
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 459 541 3.0E-09
sp|Q9Z0Z7|KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus GN=Klf5 PE=2 SV=2 423 542 3.0E-09
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 469 542 3.0E-09
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 449 539 3.0E-09
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 470 541 3.0E-09
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 470 541 3.0E-09
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 451 539 3.0E-09
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 442 541 3.0E-09
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 425 541 3.0E-09
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 469 541 3.0E-09
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 451 541 3.0E-09
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 470 541 3.0E-09
sp|P52744|ZN138_HUMAN Zinc finger protein 138 OS=Homo sapiens GN=ZNF138 PE=1 SV=2 469 540 3.0E-09
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 471 541 3.0E-09
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 470 541 3.0E-09
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 470 525 3.0E-09
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 470 541 3.0E-09
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 470 541 3.0E-09
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 447 524 3.0E-09
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 423 542 3.0E-09
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 471 539 3.0E-09
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 442 539 3.0E-09
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 451 541 3.0E-09
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 469 539 3.0E-09
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 449 539 3.0E-09
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 464 541 3.0E-09
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 471 561 3.0E-09
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 469 541 3.0E-09
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 455 539 3.0E-09
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 469 541 3.0E-09
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 422 541 3.0E-09
sp|Q9R1Y5|HIC1_MOUSE Hypermethylated in cancer 1 protein OS=Mus musculus GN=Hic1 PE=1 SV=4 471 541 3.0E-09
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 461 524 3.0E-09
sp|Q8N895|ZN366_HUMAN Zinc finger protein 366 OS=Homo sapiens GN=ZNF366 PE=1 SV=1 471 539 3.0E-09
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 449 539 3.0E-09
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 470 541 3.0E-09
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 469 541 3.0E-09
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 441 540 3.0E-09
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 442 540 3.0E-09
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 449 541 3.0E-09
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 469 540 3.0E-09
sp|Q14526|HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo sapiens GN=HIC1 PE=1 SV=5 471 539 3.0E-09
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 449 541 3.0E-09
sp|Q15916|ZBTB6_HUMAN Zinc finger and BTB domain-containing protein 6 OS=Homo sapiens GN=ZBTB6 PE=1 SV=1 464 539 3.0E-09
sp|Q0V8G8|ZBTB6_BOVIN Zinc finger and BTB domain-containing protein 6 OS=Bos taurus GN=ZBTB6 PE=2 SV=1 464 539 3.0E-09
sp|Q3US17|ZNF48_MOUSE Zinc finger protein 48 OS=Mus musculus GN=Znf48 PE=1 SV=2 467 539 3.0E-09
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 449 541 3.0E-09
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 470 541 3.0E-09
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 442 540 3.0E-09
sp|Q8K088|ZBTB6_MOUSE Zinc finger and BTB domain-containing protein 6 OS=Mus musculus GN=Zbtb6 PE=2 SV=1 464 539 3.0E-09
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 471 541 3.0E-09
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 470 540 3.0E-09
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 470 541 3.0E-09
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 471 541 3.0E-09
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 470 541 4.0E-09
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 469 539 4.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 439 540 4.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 442 541 4.0E-09
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 442 541 4.0E-09
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 442 541 4.0E-09
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 470 540 4.0E-09
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 469 541 4.0E-09
sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 452 539 4.0E-09
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 469 540 4.0E-09
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 539 4.0E-09
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 540 4.0E-09
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 441 541 4.0E-09
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 442 539 4.0E-09
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 540 4.0E-09
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 464 541 4.0E-09
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 470 541 4.0E-09
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 469 542 4.0E-09
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 455 539 4.0E-09
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 471 541 4.0E-09
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 441 540 4.0E-09
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 470 542 4.0E-09
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 471 541 4.0E-09
sp|Q90850|HIC1_CHICK Hypermethylated in cancer 1 protein (Fragment) OS=Gallus gallus GN=HIC1 PE=2 SV=2 471 539 4.0E-09
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 451 539 4.0E-09
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 470 539 4.0E-09
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 423 564 4.0E-09
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 466 539 4.0E-09
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 471 541 4.0E-09
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 451 539 4.0E-09
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 469 541 4.0E-09
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 470 541 4.0E-09
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 464 541 4.0E-09
sp|Q8N0Y2|ZN444_HUMAN Zinc finger protein 444 OS=Homo sapiens GN=ZNF444 PE=1 SV=1 442 541 4.0E-09
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 467 541 4.0E-09
sp|Q16670|ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens GN=ZSCAN26 PE=1 SV=2 470 540 4.0E-09
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 442 541 4.0E-09
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 469 541 4.0E-09
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 466 539 4.0E-09
sp|Q9N658|GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster GN=sens PE=1 SV=1 471 541 4.0E-09
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 471 541 4.0E-09
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 471 541 4.0E-09
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 471 539 4.0E-09
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 459 540 4.0E-09
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 471 541 4.0E-09
sp|P18748|ZO29_XENLA Oocyte zinc finger protein XlCOF29 OS=Xenopus laevis PE=2 SV=1 463 541 4.0E-09
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 541 4.0E-09
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 469 541 4.0E-09
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 464 541 4.0E-09
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 442 539 4.0E-09
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 470 541 5.0E-09
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 414 541 5.0E-09
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 471 541 5.0E-09
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 470 582 5.0E-09
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 540 5.0E-09
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 470 582 5.0E-09
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 470 541 5.0E-09
sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=1 SV=2 452 539 5.0E-09
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 469 543 5.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 459 541 5.0E-09
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 469 541 5.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 459 541 5.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 459 541 5.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 459 541 5.0E-09
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 539 5.0E-09
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 540 5.0E-09
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 459 541 5.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 449 541 5.0E-09
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 470 541 5.0E-09
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 471 541 5.0E-09
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 470 539 5.0E-09
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 470 539 5.0E-09
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 471 539 5.0E-09
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 459 541 5.0E-09
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 470 539 5.0E-09
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 471 561 5.0E-09
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 469 544 5.0E-09
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 540 5.0E-09
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 469 541 6.0E-09
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 459 539 6.0E-09
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 470 539 6.0E-09
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 415 541 6.0E-09
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 470 541 6.0E-09
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 470 541 6.0E-09
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 471 541 6.0E-09
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 441 544 6.0E-09
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 469 539 6.0E-09
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 471 539 6.0E-09
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 436 539 6.0E-09
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 470 541 6.0E-09
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 469 541 6.0E-09
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 416 539 6.0E-09
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 442 541 6.0E-09
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 469 541 6.0E-09
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 464 540 6.0E-09
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 470 541 6.0E-09
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 464 541 6.0E-09
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 459 539 7.0E-09
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 470 539 7.0E-09
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 470 541 7.0E-09
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 470 541 7.0E-09
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 470 541 7.0E-09
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 471 541 7.0E-09
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 459 541 7.0E-09
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 540 7.0E-09
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 470 541 7.0E-09
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 469 541 7.0E-09
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 469 541 7.0E-09
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 470 541 7.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 464 541 7.0E-09
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 469 541 7.0E-09
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 470 540 7.0E-09
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 469 541 7.0E-09
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 471 561 7.0E-09
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 470 541 8.0E-09
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 470 541 8.0E-09
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 467 539 8.0E-09
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 470 541 8.0E-09
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 450 541 8.0E-09
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 470 541 8.0E-09
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 459 541 8.0E-09
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 442 541 8.0E-09
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 439 541 8.0E-09
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 470 541 8.0E-09
sp|Q9UFB7|ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens GN=ZBTB47 PE=2 SV=3 469 541 8.0E-09
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 540 8.0E-09
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 470 539 8.0E-09
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 470 539 8.0E-09
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 469 541 8.0E-09
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 470 541 8.0E-09
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 455 540 8.0E-09
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 464 541 8.0E-09
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 470 541 8.0E-09
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 470 541 9.0E-09
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 470 541 9.0E-09
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 450 541 9.0E-09
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 471 540 9.0E-09
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 450 541 9.0E-09
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 470 540 9.0E-09
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 470 541 9.0E-09
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 470 541 9.0E-09
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 469 539 9.0E-09
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 464 541 9.0E-09
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 467 539 9.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 450 539 9.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 464 539 9.0E-09
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 470 541 9.0E-09
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 469 540 9.0E-09
sp|Q811F1|ZBT41_MOUSE Zinc finger and BTB domain-containing protein 41 OS=Mus musculus GN=Zbtb41 PE=2 SV=4 455 541 9.0E-09
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 442 541 9.0E-09
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 471 541 1.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 467 541 1.0E-08
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 470 541 1.0E-08
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 436 539 1.0E-08
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 469 541 1.0E-08
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 455 545 1.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 469 541 1.0E-08
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 459 541 1.0E-08
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 471 541 1.0E-08
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 456 541 1.0E-08
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 441 541 1.0E-08
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 450 541 1.0E-08
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 470 582 1.0E-08
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 470 540 1.0E-08
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 459 541 1.0E-08
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 470 540 1.0E-08
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 442 541 1.0E-08
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 470 541 1.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 470 541 1.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 442 541 1.0E-08
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 470 582 1.0E-08
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 469 541 1.0E-08
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 470 541 1.0E-08
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 1.0E-08
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 470 539 1.0E-08
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 470 539 1.0E-08
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 471 539 1.0E-08
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 470 541 1.0E-08
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 471 539 1.0E-08
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 421 539 1.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 441 541 1.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 442 541 1.0E-08
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 459 541 1.0E-08
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 469 541 1.0E-08
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 469 540 1.0E-08
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 462 541 1.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 442 541 1.0E-08
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 469 541 1.0E-08
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 470 541 1.0E-08
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 464 540 1.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 1.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 541 1.0E-08
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 441 541 1.0E-08
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 455 539 1.0E-08
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 470 540 1.0E-08
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 450 539 1.0E-08
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 469 541 1.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 470 539 1.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 441 541 1.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 442 541 1.0E-08
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 469 541 1.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 441 541 1.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 442 541 1.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 467 541 1.0E-08
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 466 541 1.0E-08
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 471 541 1.0E-08
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 469 539 1.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 469 541 1.0E-08
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 455 539 1.0E-08
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 470 540 1.0E-08
sp|Q8N143|BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens GN=BCL6B PE=2 SV=2 469 542 1.0E-08
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 447 541 1.0E-08
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 469 541 1.0E-08
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 358 539 1.0E-08
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 467 541 1.0E-08
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 469 541 1.0E-08
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 469 540 1.0E-08
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 471 541 1.0E-08
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 471 541 1.0E-08
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 471 541 1.0E-08
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 471 541 1.0E-08
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 442 539 1.0E-08
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 470 541 1.0E-08
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 441 541 1.0E-08
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 471 540 1.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 470 541 1.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 470 541 1.0E-08
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 470 539 1.0E-08
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 541 1.0E-08
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 544 1.0E-08
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 471 541 1.0E-08
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 469 539 1.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 470 539 1.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 470 541 1.0E-08
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 470 541 1.0E-08
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 441 541 1.0E-08
sp|Q5SVQ8|ZBT41_HUMAN Zinc finger and BTB domain-containing protein 41 OS=Homo sapiens GN=ZBTB41 PE=1 SV=1 455 541 1.0E-08
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 471 541 1.0E-08
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 469 541 1.0E-08
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 442 541 1.0E-08
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 470 541 1.0E-08
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 471 541 1.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 453 541 1.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 469 540 1.0E-08
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 471 541 1.0E-08
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 470 541 1.0E-08
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 470 553 1.0E-08
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 469 540 1.0E-08
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 455 541 1.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 470 541 2.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 471 539 2.0E-08
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 470 541 2.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 470 541 2.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 467 544 2.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 470 541 2.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 467 544 2.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 470 541 2.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 470 540 2.0E-08
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 470 541 2.0E-08
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 470 539 2.0E-08
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 470 541 2.0E-08
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 470 539 2.0E-08
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 470 541 2.0E-08
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 470 539 2.0E-08
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 470 541 2.0E-08
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 470 539 2.0E-08
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 470 582 2.0E-08
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 470 541 2.0E-08
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 470 541 2.0E-08
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 470 541 2.0E-08
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 464 541 2.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 464 541 2.0E-08
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 470 540 2.0E-08
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 470 582 2.0E-08
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 470 540 2.0E-08
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 440 540 2.0E-08
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 455 539 2.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 439 541 2.0E-08
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 459 530 2.0E-08
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 469 539 2.0E-08
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 469 541 2.0E-08
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 469 539 2.0E-08
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 470 541 2.0E-08
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 539 2.0E-08
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 471 539 2.0E-08
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 461 539 2.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 459 540 2.0E-08
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 469 540 2.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 459 540 2.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 441 541 2.0E-08
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 469 539 2.0E-08
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 469 541 2.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 2.0E-08
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 541 2.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 539 2.0E-08
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 467 539 2.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 470 541 2.0E-08
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 541 2.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 459 540 2.0E-08
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 471 541 2.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 459 540 2.0E-08
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 470 539 2.0E-08
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 462 541 2.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 470 539 2.0E-08
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 471 544 2.0E-08
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 462 541 2.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 470 541 2.0E-08
sp|Q5RJ54|ZSC26_MOUSE Zinc finger and SCAN domain-containing protein 26 OS=Mus musculus GN=Zscan26 PE=2 SV=1 421 541 2.0E-08
sp|O88282|BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus GN=Bcl6b PE=1 SV=1 469 542 2.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 464 541 2.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 470 539 2.0E-08
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 470 541 2.0E-08
sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 442 539 2.0E-08
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 467 541 2.0E-08
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 469 539 2.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 470 541 2.0E-08
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 467 541 2.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 470 541 2.0E-08
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 467 541 2.0E-08
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 467 541 2.0E-08
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 470 541 2.0E-08
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 470 541 2.0E-08
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 471 539 2.0E-08
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 540 2.0E-08
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 466 540 2.0E-08
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 472 543 2.0E-08
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 469 539 2.0E-08
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 470 539 2.0E-08
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 432 544 2.0E-08
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 453 539 2.0E-08
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 470 539 2.0E-08
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 470 541 2.0E-08
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 470 541 2.0E-08
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 471 541 2.0E-08
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 435 539 2.0E-08
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 470 540 2.0E-08
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 442 541 2.0E-08
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 459 541 2.0E-08
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 470 541 2.0E-08
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 470 541 2.0E-08
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 470 541 2.0E-08
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 470 541 2.0E-08
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 467 540 2.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 470 540 2.0E-08
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 464 540 2.0E-08
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 469 541 2.0E-08
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 467 541 2.0E-08
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 469 539 2.0E-08
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 469 540 2.0E-08
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 540 2.0E-08
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 471 541 2.0E-08
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 464 540 2.0E-08
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 469 541 2.0E-08
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 469 541 2.0E-08
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 469 541 3.0E-08
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 464 539 3.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 470 541 3.0E-08
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 465 541 3.0E-08
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 470 541 3.0E-08
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 471 541 3.0E-08
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 471 541 3.0E-08
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 470 541 3.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 470 541 3.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 465 541 3.0E-08
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 470 541 3.0E-08
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 3.0E-08
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 464 541 3.0E-08
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 470 541 3.0E-08
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 469 539 3.0E-08
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 469 540 3.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 471 541 3.0E-08
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 471 542 3.0E-08
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 469 539 3.0E-08
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 469 539 3.0E-08
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 461 539 3.0E-08
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 470 541 3.0E-08
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 464 541 3.0E-08
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 454 539 3.0E-08
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 436 539 3.0E-08
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 436 539 3.0E-08
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 454 539 3.0E-08
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 459 521 3.0E-08
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 454 539 3.0E-08
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 469 540 3.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 441 541 3.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 441 541 3.0E-08
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 470 541 3.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 541 3.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 441 541 3.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 442 544 3.0E-08
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 470 541 3.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 441 541 3.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 442 541 3.0E-08
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 441 541 3.0E-08
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 459 530 3.0E-08
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 541 3.0E-08
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 470 539 3.0E-08
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 464 541 3.0E-08
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 469 541 3.0E-08
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 469 540 3.0E-08
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 455 541 3.0E-08
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 469 541 3.0E-08
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 453 540 3.0E-08
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 462 541 3.0E-08
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 470 541 3.0E-08
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 455 541 3.0E-08
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 445 539 3.0E-08
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 469 541 3.0E-08
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 471 540 3.0E-08
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 469 541 3.0E-08
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 471 539 3.0E-08
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 471 542 3.0E-08
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 470 541 3.0E-08
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 469 540 3.0E-08
sp|P18748|ZO29_XENLA Oocyte zinc finger protein XlCOF29 OS=Xenopus laevis PE=2 SV=1 470 541 3.0E-08
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 469 540 3.0E-08
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 471 541 4.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 467 541 4.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 470 541 4.0E-08
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 436 539 4.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 450 539 4.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 470 541 4.0E-08
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 464 539 4.0E-08
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 470 541 4.0E-08
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 454 539 4.0E-08
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 470 541 4.0E-08
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 459 539 4.0E-08
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 470 541 4.0E-08
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 459 539 4.0E-08
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 470 541 4.0E-08
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 459 539 4.0E-08
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 470 541 4.0E-08
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 459 539 4.0E-08
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 470 539 4.0E-08
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 470 541 4.0E-08
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 469 558 4.0E-08
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 470 541 4.0E-08
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 470 541 4.0E-08
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 457 541 4.0E-08
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 469 540 4.0E-08
sp|Q66K89|E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens GN=E4F1 PE=1 SV=2 461 539 4.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 462 544 4.0E-08
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 469 541 4.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 4.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 541 4.0E-08
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 470 541 4.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 470 539 4.0E-08
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 541 4.0E-08
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 469 541 4.0E-08
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 464 540 4.0E-08
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 470 541 4.0E-08
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 470 530 4.0E-08
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 459 544 4.0E-08
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 444 542 4.0E-08
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 469 541 4.0E-08
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 466 521 4.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 440 541 4.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 470 541 4.0E-08
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 539 4.0E-08
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 470 531 4.0E-08
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 469 541 4.0E-08
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 464 539 4.0E-08
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 470 539 4.0E-08
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 469 541 4.0E-08
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 470 539 4.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 470 541 4.0E-08
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 469 540 4.0E-08
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 470 541 4.0E-08
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 467 541 4.0E-08
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 470 539 4.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 470 540 4.0E-08
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 469 541 4.0E-08
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 540 4.0E-08
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 471 539 4.0E-08
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 470 542 4.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 471 541 4.0E-08
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 470 541 4.0E-08
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 470 539 4.0E-08
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 470 539 4.0E-08
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 467 540 4.0E-08
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 467 540 4.0E-08
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 541 4.0E-08
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 467 556 5.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 470 539 5.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 470 539 5.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 471 540 5.0E-08
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 470 543 5.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 465 541 5.0E-08
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 467 539 5.0E-08
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 412 541 5.0E-08
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 460 541 5.0E-08
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 470 540 5.0E-08
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 459 539 5.0E-08
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 470 539 5.0E-08
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 467 539 5.0E-08
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 467 539 5.0E-08
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 460 541 5.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 5.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 539 5.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 470 540 5.0E-08
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 456 541 5.0E-08
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 469 542 5.0E-08
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 470 541 5.0E-08
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 469 541 5.0E-08
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 466 521 5.0E-08
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 466 521 5.0E-08
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 470 541 5.0E-08
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 470 541 5.0E-08
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 471 541 5.0E-08
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 441 539 5.0E-08
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 469 541 5.0E-08
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 469 541 5.0E-08
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 457 540 5.0E-08
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 464 539 5.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 470 541 5.0E-08
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 471 541 5.0E-08
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 471 541 5.0E-08
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 470 541 5.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 471 541 5.0E-08
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 471 544 5.0E-08
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 470 540 5.0E-08
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 469 541 5.0E-08
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 469 539 5.0E-08
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 469 541 5.0E-08
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 470 541 5.0E-08
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 470 541 5.0E-08
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 6.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 470 541 6.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 469 541 6.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 469 541 6.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 470 540 6.0E-08
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 469 540 6.0E-08
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 471 539 6.0E-08
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 471 541 6.0E-08
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 454 539 6.0E-08
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 454 539 6.0E-08
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 470 541 6.0E-08
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 469 540 6.0E-08
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 471 539 6.0E-08
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 439 539 6.0E-08
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 455 541 6.0E-08
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 540 6.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 471 541 6.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 471 541 6.0E-08
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 467 541 6.0E-08
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 455 541 6.0E-08
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 469 540 6.0E-08
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 450 539 6.0E-08
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 469 541 6.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 470 541 6.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 469 541 6.0E-08
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 470 541 6.0E-08
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 470 541 6.0E-08
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 470 541 6.0E-08
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 469 541 6.0E-08
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 469 541 6.0E-08
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 470 541 6.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 468 541 6.0E-08
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 470 541 6.0E-08
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 471 539 6.0E-08
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 470 544 6.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 453 540 6.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 470 539 6.0E-08
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 469 544 6.0E-08
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 440 541 6.0E-08
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 469 540 6.0E-08
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 471 539 7.0E-08
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 470 541 7.0E-08
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 470 541 7.0E-08
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 450 539 7.0E-08
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 470 541 7.0E-08
sp|P18716|ZG28_XENLA Gastrula zinc finger protein XlCGF28.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 539 7.0E-08
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 470 541 7.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 469 541 7.0E-08
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 469 542 7.0E-08
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 469 542 7.0E-08
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 470 541 7.0E-08
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 540 7.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 450 532 7.0E-08
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 454 539 7.0E-08
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 470 541 7.0E-08
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 471 539 7.0E-08
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 469 541 7.0E-08
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 469 541 7.0E-08
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 471 540 7.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 467 541 7.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 470 541 7.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 470 541 7.0E-08
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 470 541 7.0E-08
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 470 542 7.0E-08
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 464 540 7.0E-08
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 470 541 7.0E-08
sp|P52744|ZN138_HUMAN Zinc finger protein 138 OS=Homo sapiens GN=ZNF138 PE=1 SV=2 469 540 7.0E-08
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 469 541 7.0E-08
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 470 540 7.0E-08
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 469 539 7.0E-08
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 471 541 8.0E-08
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 471 539 8.0E-08
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 468 541 8.0E-08
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 541 8.0E-08
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 442 540 8.0E-08
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 470 541 8.0E-08
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 470 541 8.0E-08
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 470 541 8.0E-08
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 471 539 8.0E-08
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 469 540 8.0E-08
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 469 540 8.0E-08
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 469 541 8.0E-08
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 469 541 8.0E-08
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 469 539 8.0E-08
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 469 540 8.0E-08
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 539 8.0E-08
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 467 541 8.0E-08
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 470 541 8.0E-08
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 466 521 8.0E-08
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 540 8.0E-08
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 470 542 8.0E-08
sp|Q6P2A1|PRDM9_DANRE Histone-lysine N-methyltransferase PRDM9 OS=Danio rerio GN=prdm9 PE=2 SV=1 467 542 8.0E-08
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 469 539 8.0E-08
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 470 541 8.0E-08
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 469 541 8.0E-08
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 469 539 8.0E-08
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 470 541 8.0E-08
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 470 541 8.0E-08
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 471 541 8.0E-08
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 471 539 8.0E-08
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 469 541 8.0E-08
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 469 540 8.0E-08
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 471 539 9.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 469 541 9.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 469 541 9.0E-08
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 471 541 9.0E-08
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 470 541 9.0E-08
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 469 553 9.0E-08
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 459 521 9.0E-08
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 471 540 9.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 541 9.0E-08
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 454 539 9.0E-08
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 447 539 9.0E-08
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 469 541 9.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 471 541 9.0E-08
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 471 541 9.0E-08
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 455 540 9.0E-08
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 470 541 9.0E-08
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 450 541 9.0E-08
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 469 539 9.0E-08
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 469 541 9.0E-08
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 469 539 9.0E-08
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 469 549 9.0E-08
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 470 542 9.0E-08
sp|Q9N658|GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster GN=sens PE=1 SV=1 469 542 9.0E-08
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 471 541 1.0E-07
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 471 567 1.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 451 541 1.0E-07
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 469 539 1.0E-07
sp|P57071|PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens GN=PRDM15 PE=2 SV=4 467 540 1.0E-07
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 464 540 1.0E-07
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 464 540 1.0E-07
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 470 539 1.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 470 541 1.0E-07
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 459 549 1.0E-07
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 469 540 1.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 471 539 1.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 467 541 1.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 540 1.0E-07
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 471 541 1.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 469 540 1.0E-07
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 470 539 1.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 466 541 1.0E-07
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 459 549 1.0E-07
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 470 541 1.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 459 541 1.0E-07
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 471 540 1.0E-07
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 470 541 1.0E-07
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 470 542 1.0E-07
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 470 541 1.0E-07
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 459 539 1.0E-07
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 469 549 1.0E-07
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 461 539 1.0E-07
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 470 541 1.0E-07
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 461 539 1.0E-07
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 439 539 1.0E-07
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 466 540 1.0E-07
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 466 540 1.0E-07
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 469 541 1.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 539 1.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 464 539 1.0E-07
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 470 539 1.0E-07
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 471 541 1.0E-07
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 464 541 1.0E-07
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 470 541 1.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 540 1.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 539 1.0E-07
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 469 539 1.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 450 539 1.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 466 539 1.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 464 539 1.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 472 541 1.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 469 539 1.0E-07
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 469 540 1.0E-07
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 471 544 1.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 455 541 1.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 540 1.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 470 541 1.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 470 541 1.0E-07
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 470 541 1.0E-07
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 470 539 1.0E-07
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 470 539 1.0E-07
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 470 539 1.0E-07
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 470 539 1.0E-07
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 471 541 1.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 469 541 1.0E-07
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 470 541 1.0E-07
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 470 541 1.0E-07
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 470 539 1.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 451 541 1.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 469 560 1.0E-07
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 470 541 1.0E-07
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 459 541 1.0E-07
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 540 1.0E-07
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 541 1.0E-07
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 470 541 1.0E-07
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 469 539 1.0E-07
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 470 539 1.0E-07
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 470 541 1.0E-07
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 464 541 1.0E-07
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 471 540 1.0E-07
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 470 541 1.0E-07
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 469 539 1.0E-07
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 470 541 1.0E-07
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 471 540 1.0E-07
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 470 541 1.0E-07
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 450 541 1.0E-07
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 470 540 1.0E-07
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 471 539 1.0E-07
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 469 540 1.0E-07
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 467 541 1.0E-07
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 469 541 1.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 470 539 1.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 469 540 1.0E-07
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 469 541 1.0E-07
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 384 541 1.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 470 541 1.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 470 541 1.0E-07
sp|P18748|ZO29_XENLA Oocyte zinc finger protein XlCOF29 OS=Xenopus laevis PE=2 SV=1 470 539 1.0E-07
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 471 539 2.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 470 539 2.0E-07
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 470 539 2.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 470 539 2.0E-07
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 471 542 2.0E-07
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 471 541 2.0E-07
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 471 541 2.0E-07
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 469 541 2.0E-07
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 469 541 2.0E-07
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 469 539 2.0E-07
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 464 540 2.0E-07
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 451 541 2.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 470 541 2.0E-07
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 451 541 2.0E-07
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 469 540 2.0E-07
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 469 541 2.0E-07
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 459 549 2.0E-07
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 464 541 2.0E-07
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 2.0E-07
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 470 541 2.0E-07
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 471 541 2.0E-07
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 470 541 2.0E-07
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 464 651 2.0E-07
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 464 541 2.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 470 540 2.0E-07
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 464 541 2.0E-07
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 459 540 2.0E-07
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 464 539 2.0E-07
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 469 539 2.0E-07
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 469 540 2.0E-07
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 471 541 2.0E-07
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 470 541 2.0E-07
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 541 2.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 2.0E-07
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 541 2.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 540 2.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 545 2.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 470 539 2.0E-07
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 470 541 2.0E-07
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 549 2.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 470 540 2.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 470 541 2.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 453 540 2.0E-07
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 469 541 2.0E-07
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 469 541 2.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 470 540 2.0E-07
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 470 543 2.0E-07
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 470 541 2.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 470 542 2.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 445 541 2.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 540 2.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 541 2.0E-07
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 470 541 2.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 469 541 2.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 469 541 2.0E-07
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 467 541 2.0E-07
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 469 540 2.0E-07
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 471 541 2.0E-07
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 470 539 2.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 469 539 2.0E-07
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 470 541 2.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 442 541 2.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 469 540 2.0E-07
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 470 541 2.0E-07
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 470 541 2.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 469 541 2.0E-07
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 441 541 2.0E-07
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 469 541 2.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 470 541 2.0E-07
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 469 539 2.0E-07
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 470 541 2.0E-07
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 464 541 2.0E-07
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 469 541 2.0E-07
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 459 541 2.0E-07
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 469 541 2.0E-07
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 471 541 2.0E-07
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 470 541 2.0E-07
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 470 541 2.0E-07
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 471 541 2.0E-07
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 470 541 2.0E-07
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 471 541 2.0E-07
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 467 541 2.0E-07
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 464 540 2.0E-07
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 470 541 2.0E-07
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 442 541 2.0E-07
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 469 541 2.0E-07
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 449 541 2.0E-07
sp|P52744|ZN138_HUMAN Zinc finger protein 138 OS=Homo sapiens GN=ZNF138 PE=1 SV=2 469 540 2.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 469 539 2.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 470 541 2.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 471 541 2.0E-07
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 470 541 2.0E-07
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 470 541 2.0E-07
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 463 542 2.0E-07
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 470 539 2.0E-07
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 470 541 2.0E-07
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 449 541 2.0E-07
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 442 541 2.0E-07
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 470 539 2.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 470 539 2.0E-07
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 469 539 2.0E-07
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 470 541 2.0E-07
sp|Q07120|GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus GN=Gfi1 PE=1 SV=1 469 539 2.0E-07
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 470 541 2.0E-07
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 470 541 2.0E-07
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 471 539 2.0E-07
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 470 541 2.0E-07
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 471 541 2.0E-07
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 469 541 2.0E-07
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 469 541 2.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 454 541 2.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 470 541 2.0E-07
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 469 541 2.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 454 541 2.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 470 541 2.0E-07
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 540 2.0E-07
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 468 539 2.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 442 539 2.0E-07
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 486 541 3.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 470 539 3.0E-07
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 470 541 3.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 442 541 3.0E-07
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 469 541 3.0E-07
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 469 541 3.0E-07
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 470 549 3.0E-07
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 470 541 3.0E-07
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 470 541 3.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 469 544 3.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 540 3.0E-07
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 470 540 3.0E-07
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 450 539 3.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 471 540 3.0E-07
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 469 542 3.0E-07
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 469 542 3.0E-07
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 471 541 3.0E-07
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 470 541 3.0E-07
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 464 541 3.0E-07
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 469 541 3.0E-07
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 464 541 3.0E-07
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 471 541 3.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 470 540 3.0E-07
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 469 541 3.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 541 3.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 3.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 541 3.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 470 541 3.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 541 3.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 469 539 3.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 469 539 3.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 471 541 3.0E-07
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 469 539 3.0E-07
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 470 541 3.0E-07
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 471 541 3.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 540 3.0E-07
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 464 668 3.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 469 541 3.0E-07
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 471 541 3.0E-07
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 462 541 3.0E-07
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 469 541 3.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 415 541 3.0E-07
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 469 541 3.0E-07
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 470 539 3.0E-07
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 453 539 3.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 470 541 3.0E-07
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 467 541 3.0E-07
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 469 541 3.0E-07
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 469 541 3.0E-07
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 470 539 3.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 469 539 3.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 470 539 3.0E-07
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 470 541 3.0E-07
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 455 541 3.0E-07
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 471 541 3.0E-07
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 469 541 3.0E-07
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 471 541 3.0E-07
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 457 541 3.0E-07
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 419 541 3.0E-07
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 469 541 3.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 470 539 3.0E-07
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 471 541 3.0E-07
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 471 541 3.0E-07
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 470 541 3.0E-07
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 442 539 3.0E-07
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 470 540 3.0E-07
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 469 541 3.0E-07
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 470 540 3.0E-07
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 470 539 3.0E-07
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 471 539 3.0E-07
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 441 541 3.0E-07
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 471 541 3.0E-07
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 541 3.0E-07
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 540 3.0E-07
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 541 3.0E-07
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 469 539 3.0E-07
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 471 541 4.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 470 539 4.0E-07
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 469 539 4.0E-07
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 470 541 4.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 442 541 4.0E-07
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 459 541 4.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 470 539 4.0E-07
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 469 541 4.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 471 541 4.0E-07
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 470 539 4.0E-07
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 470 541 4.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 470 541 4.0E-07
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 470 541 4.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 469 541 4.0E-07
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 470 541 4.0E-07
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 470 541 4.0E-07
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 470 541 4.0E-07
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 471 541 4.0E-07
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 470 539 4.0E-07
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 471 541 4.0E-07
sp|Q5ZM39|BCL6_CHICK B-cell lymphoma 6 protein homolog OS=Gallus gallus GN=BCL6 PE=2 SV=1 469 542 4.0E-07
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 469 541 4.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 471 541 4.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 4.0E-07
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 469 541 4.0E-07
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 470 541 4.0E-07
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 469 539 4.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 541 4.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 4.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 541 4.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 459 539 4.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 471 541 4.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 442 539 4.0E-07
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 471 539 4.0E-07
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 470 541 4.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 471 541 4.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 450 539 4.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 541 4.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 470 541 4.0E-07
sp|O88282|BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus GN=Bcl6b PE=1 SV=1 454 539 4.0E-07
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 437 541 4.0E-07
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 470 553 4.0E-07
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 470 553 4.0E-07
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 470 553 4.0E-07
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 470 553 4.0E-07
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 470 541 4.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 471 541 4.0E-07
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 470 541 4.0E-07
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 471 540 4.0E-07
sp|Q9H4T2|ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens GN=ZSCAN16 PE=1 SV=2 469 541 4.0E-07
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 471 541 4.0E-07
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 453 539 4.0E-07
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 470 541 4.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 450 541 4.0E-07
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 468 540 4.0E-07
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 471 541 4.0E-07
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 442 541 4.0E-07
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 486 539 4.0E-07
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 469 539 4.0E-07
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 470 540 4.0E-07
sp|Q3US17|ZNF48_MOUSE Zinc finger protein 48 OS=Mus musculus GN=Znf48 PE=1 SV=2 471 540 4.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 470 541 4.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 470 541 4.0E-07
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 470 540 4.0E-07
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 451 541 4.0E-07
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 442 541 4.0E-07
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 470 541 4.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 470 541 4.0E-07
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 469 541 4.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 470 541 4.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 470 539 4.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 470 541 5.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 470 541 5.0E-07
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 471 539 5.0E-07
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 471 541 5.0E-07
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 471 539 5.0E-07
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 471 541 5.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 469 541 5.0E-07
sp|P18716|ZG28_XENLA Gastrula zinc finger protein XlCGF28.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 539 5.0E-07
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 470 541 5.0E-07
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 470 539 5.0E-07
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 470 540 5.0E-07
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 469 540 5.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 470 540 5.0E-07
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 470 541 5.0E-07
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 469 540 5.0E-07
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 469 540 5.0E-07
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 470 541 5.0E-07
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 471 539 5.0E-07
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 470 539 5.0E-07
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 469 541 5.0E-07
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 471 541 5.0E-07
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 469 540 5.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 471 541 5.0E-07
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 446 539 5.0E-07
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 471 541 5.0E-07
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 541 5.0E-07
sp|Q9QZP2|PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus GN=Prdm4 PE=2 SV=1 471 539 5.0E-07
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 469 541 5.0E-07
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 470 541 5.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 466 541 5.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 471 541 5.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 470 541 5.0E-07
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 471 539 5.0E-07
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 470 539 5.0E-07
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 471 539 5.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 470 541 5.0E-07
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 469 539 5.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 442 541 5.0E-07
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 463 539 6.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 470 541 6.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 470 541 6.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 470 541 6.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 442 541 6.0E-07
sp|P18752|ZO72_XENLA Oocyte zinc finger protein XlCOF7.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 541 6.0E-07
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 442 541 6.0E-07
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 466 539 6.0E-07
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 471 539 6.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 469 544 6.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 469 540 6.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 469 541 6.0E-07
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 464 548 6.0E-07
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 361 523 6.0E-07
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 471 542 6.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 470 539 6.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 470 539 6.0E-07
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 469 540 6.0E-07
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 469 540 6.0E-07
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 540 6.0E-07
sp|Q80V63|PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus GN=Prdm4 PE=2 SV=2 471 539 6.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 541 6.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 470 541 6.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 470 541 6.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 464 540 6.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 540 6.0E-07
sp|Q8N143|BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens GN=BCL6B PE=2 SV=2 457 539 6.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 469 541 6.0E-07
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 540 6.0E-07
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 543 6.0E-07
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 471 541 6.0E-07
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 469 539 6.0E-07
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 454 541 6.0E-07
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 470 541 6.0E-07
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 471 541 6.0E-07
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 471 539 6.0E-07
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 470 539 6.0E-07
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 467 539 7.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 470 541 7.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 469 541 7.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 470 539 7.0E-07
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 470 541 7.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 471 539 7.0E-07
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 469 541 7.0E-07
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 471 541 7.0E-07
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 470 539 7.0E-07
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 471 540 7.0E-07
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 469 541 7.0E-07
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 469 541 7.0E-07
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 470 541 7.0E-07
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 464 540 7.0E-07
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 470 539 7.0E-07
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 471 539 7.0E-07
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 471 539 7.0E-07
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 471 539 7.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 541 7.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 471 541 7.0E-07
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 469 541 7.0E-07
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 470 539 7.0E-07
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 470 541 7.0E-07
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 470 541 7.0E-07
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 469 540 7.0E-07
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 471 541 7.0E-07
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 470 541 7.0E-07
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 469 541 7.0E-07
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 469 541 7.0E-07
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 470 539 7.0E-07
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 470 539 7.0E-07
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 469 541 8.0E-07
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 471 541 8.0E-07
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 464 520 8.0E-07
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 470 541 8.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 470 540 8.0E-07
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 469 541 8.0E-07
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 471 542 8.0E-07
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 442 541 8.0E-07
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 467 541 8.0E-07
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 469 541 8.0E-07
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 541 8.0E-07
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 541 8.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 450 539 8.0E-07
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 470 541 8.0E-07
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 469 540 8.0E-07
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 454 541 8.0E-07
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 470 539 8.0E-07
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 471 539 8.0E-07
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 471 539 8.0E-07
sp|Q6P2A1|PRDM9_DANRE Histone-lysine N-methyltransferase PRDM9 OS=Danio rerio GN=prdm9 PE=2 SV=1 459 541 8.0E-07
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 441 541 8.0E-07
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 470 541 8.0E-07
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 471 541 8.0E-07
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 470 541 8.0E-07
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 471 541 8.0E-07
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 471 539 8.0E-07
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 469 540 8.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 468 539 9.0E-07
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 470 541 9.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 539 9.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 464 539 9.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 469 541 9.0E-07
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 462 541 9.0E-07
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 470 540 9.0E-07
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 470 540 9.0E-07
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 469 540 9.0E-07
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 471 539 9.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 472 552 9.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 541 9.0E-07
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 469 541 9.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 470 540 9.0E-07
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 469 541 9.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 470 541 9.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 470 541 9.0E-07
sp|Q811F1|ZBT41_MOUSE Zinc finger and BTB domain-containing protein 41 OS=Mus musculus GN=Zbtb41 PE=2 SV=4 469 539 9.0E-07
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 469 541 9.0E-07
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 455 541 9.0E-07
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 471 541 9.0E-07
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 470 542 9.0E-07
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 471 541 9.0E-07
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 471 541 9.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 470 540 9.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 470 540 9.0E-07
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 471 539 1.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 467 539 1.0E-06
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 471 541 1.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 471 541 1.0E-06
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 470 541 1.0E-06
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 464 541 1.0E-06
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 540 1.0E-06
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 470 539 1.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 470 540 1.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 470 539 1.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 471 541 1.0E-06
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 471 541 1.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 471 539 1.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 470 541 1.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 540 1.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 470 541 1.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 468 541 1.0E-06
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 469 540 1.0E-06
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 484 540 1.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 470 541 1.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 469 541 1.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 469 540 1.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 455 542 1.0E-06
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 462 541 1.0E-06
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 460 539 1.0E-06
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 460 539 1.0E-06
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 442 540 1.0E-06
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 470 541 1.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 470 539 1.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 470 539 1.0E-06
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 469 541 1.0E-06
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 464 541 1.0E-06
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 471 541 1.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 469 540 1.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 469 541 1.0E-06
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 469 541 1.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 469 540 1.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 470 540 1.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 471 541 1.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 541 1.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 541 1.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 470 539 1.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 541 1.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 541 1.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 470 539 1.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 455 539 1.0E-06
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 449 541 1.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 470 541 1.0E-06
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 469 541 1.0E-06
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 470 541 1.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 541 1.0E-06
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 470 540 1.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 442 539 1.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 470 539 1.0E-06
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 442 523 1.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 470 541 1.0E-06
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 471 545 1.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 470 541 1.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 470 541 1.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 470 541 1.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 469 541 1.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 471 541 1.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 467 541 1.0E-06
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 469 541 1.0E-06
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 472 541 1.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 469 541 1.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 470 539 1.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 470 550 1.0E-06
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 469 541 1.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 470 539 1.0E-06
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 470 540 1.0E-06
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 471 540 1.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 540 1.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 541 1.0E-06
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 471 541 1.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 470 541 1.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 470 541 1.0E-06
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 470 539 1.0E-06
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 470 541 1.0E-06
sp|Q5SVQ8|ZBT41_HUMAN Zinc finger and BTB domain-containing protein 41 OS=Homo sapiens GN=ZBTB41 PE=1 SV=1 469 539 1.0E-06
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 470 539 1.0E-06
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 469 540 1.0E-06
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 472 530 1.0E-06
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 469 539 1.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 541 1.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 541 1.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 471 541 1.0E-06
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 470 541 1.0E-06
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 469 541 1.0E-06
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 469 541 1.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 471 541 1.0E-06
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 470 541 1.0E-06
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 469 541 1.0E-06
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 469 541 1.0E-06
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 470 540 1.0E-06
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 469 541 1.0E-06
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 471 541 1.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 470 541 1.0E-06
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 471 541 1.0E-06
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 451 541 1.0E-06
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 449 541 1.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 471 541 1.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 470 539 1.0E-06
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 470 541 1.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 467 541 1.0E-06
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 451 541 1.0E-06
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 469 540 1.0E-06
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 471 541 2.0E-06
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 471 541 2.0E-06
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 469 541 2.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 470 541 2.0E-06
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 463 539 2.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 470 541 2.0E-06
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 447 521 2.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 469 541 2.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 469 541 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 470 541 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 464 539 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 464 539 2.0E-06
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 541 2.0E-06
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 471 541 2.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 471 541 2.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 470 541 2.0E-06
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 471 541 2.0E-06
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 447 520 2.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 541 2.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 450 539 2.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 469 539 2.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 467 539 2.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 472 541 2.0E-06
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 470 541 2.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 469 540 2.0E-06
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 469 539 2.0E-06
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 470 541 2.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 467 539 2.0E-06
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 444 539 2.0E-06
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 444 539 2.0E-06
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 464 523 2.0E-06
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 469 541 2.0E-06
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 469 541 2.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 470 540 2.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 471 541 2.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 470 540 2.0E-06
sp|Q5ZM39|BCL6_CHICK B-cell lymphoma 6 protein homolog OS=Gallus gallus GN=BCL6 PE=2 SV=1 460 539 2.0E-06
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 441 539 2.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 471 541 2.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 471 541 2.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 471 541 2.0E-06
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 470 539 2.0E-06
sp|Q8N1W2|ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens GN=ZNF710 PE=2 SV=2 441 539 2.0E-06
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 455 539 2.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 471 541 2.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 469 539 2.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 471 541 2.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 470 540 2.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 470 541 2.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 470 539 2.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 471 541 2.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 469 539 2.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 470 540 2.0E-06
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 471 545 2.0E-06
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 469 541 2.0E-06
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 470 539 2.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 541 2.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 470 541 2.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 470 540 2.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 470 539 2.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 471 541 2.0E-06
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 469 539 2.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 470 541 2.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 467 539 2.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 442 541 2.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 470 541 2.0E-06
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 450 540 2.0E-06
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 440 539 2.0E-06
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 469 541 2.0E-06
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 467 539 2.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 454 550 2.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 471 541 2.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 471 541 2.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 469 541 2.0E-06
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 469 541 2.0E-06
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 470 541 2.0E-06
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 470 539 2.0E-06
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 471 539 2.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 469 541 2.0E-06
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 470 541 2.0E-06
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 470 541 2.0E-06
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 470 540 2.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 469 540 2.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 452 541 2.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 470 541 2.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 470 539 2.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 471 539 2.0E-06
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 469 539 2.0E-06
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 469 541 2.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 411 539 2.0E-06
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 486 539 2.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 471 541 2.0E-06
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 470 539 2.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 467 541 2.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 470 540 2.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 469 541 2.0E-06
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 455 540 2.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 470 539 2.0E-06
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 469 539 2.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 470 539 2.0E-06
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 470 541 2.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 453 540 2.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 470 541 2.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 466 541 2.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 470 540 2.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 459 541 2.0E-06
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 470 541 2.0E-06
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 442 539 2.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 471 543 2.0E-06
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 466 539 2.0E-06
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 469 541 2.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 470 541 2.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 451 539 2.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 470 541 2.0E-06
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 442 541 2.0E-06
sp|P52744|ZN138_HUMAN Zinc finger protein 138 OS=Homo sapiens GN=ZNF138 PE=1 SV=2 471 530 2.0E-06
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 469 541 2.0E-06
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 470 541 2.0E-06
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 469 541 2.0E-06
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 442 541 2.0E-06
sp|Q9R1Y5|HIC1_MOUSE Hypermethylated in cancer 1 protein OS=Mus musculus GN=Hic1 PE=1 SV=4 471 539 2.0E-06
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 469 539 2.0E-06
sp|Q14526|HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo sapiens GN=HIC1 PE=1 SV=5 471 539 2.0E-06
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 469 541 2.0E-06
sp|Q90850|HIC1_CHICK Hypermethylated in cancer 1 protein (Fragment) OS=Gallus gallus GN=HIC1 PE=2 SV=2 471 539 2.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 467 541 2.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 470 541 2.0E-06
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 470 530 2.0E-06
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 471 542 2.0E-06
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 469 530 2.0E-06
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 470 540 2.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 404 541 2.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 433 540 2.0E-06
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 539 2.0E-06
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 469 541 2.0E-06
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 469 541 2.0E-06
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 471 539 3.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 470 541 3.0E-06
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 458 539 3.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 469 541 3.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 471 539 3.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 470 539 3.0E-06
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 459 517 3.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 470 539 3.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 470 539 3.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 471 541 3.0E-06
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 464 531 3.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 470 539 3.0E-06
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 467 541 3.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 470 539 3.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 469 541 3.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 469 541 3.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 464 539 3.0E-06
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 516 3.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 434 541 3.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 469 539 3.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 470 541 3.0E-06
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 464 516 3.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 470 542 3.0E-06
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 464 516 3.0E-06
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 469 542 3.0E-06
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 469 539 3.0E-06
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 469 539 3.0E-06
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 464 531 3.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 471 541 3.0E-06
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 469 540 3.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 471 541 3.0E-06
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 470 541 3.0E-06
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 472 541 3.0E-06
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 445 539 3.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 470 541 3.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 470 541 3.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 470 541 3.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 3.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 471 541 3.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 466 541 3.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 470 540 3.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 471 541 3.0E-06
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 469 541 3.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 469 540 3.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 470 541 3.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 470 540 3.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 469 541 3.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 469 540 3.0E-06
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 421 541 3.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 470 541 3.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 472 539 3.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 469 541 3.0E-06
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 470 530 3.0E-06
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 469 541 3.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 470 541 3.0E-06
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 469 541 3.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 470 542 3.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 470 541 3.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 541 3.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 441 541 3.0E-06
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 460 539 3.0E-06
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 471 541 3.0E-06
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 470 539 3.0E-06
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 455 541 3.0E-06
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 440 541 3.0E-06
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 450 539 3.0E-06
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 469 541 3.0E-06
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 469 540 3.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 470 541 3.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 433 540 3.0E-06
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 540 3.0E-06
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 471 541 4.0E-06
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 467 541 4.0E-06
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 469 540 4.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 467 541 4.0E-06
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 467 541 4.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 470 541 4.0E-06
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 471 541 4.0E-06
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 471 541 4.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 471 541 4.0E-06
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 441 541 4.0E-06
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 451 539 4.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 470 541 4.0E-06
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 464 523 4.0E-06
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 470 541 4.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 471 539 4.0E-06
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 467 541 4.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 541 4.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 537 4.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 541 4.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 466 541 4.0E-06
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 469 539 4.0E-06
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 459 541 4.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 471 539 4.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 466 541 4.0E-06
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 470 539 4.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 469 541 4.0E-06
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 471 541 4.0E-06
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 471 541 4.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 469 541 4.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 470 541 4.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 469 541 4.0E-06
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 450 539 4.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 471 541 4.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 471 541 4.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 471 541 4.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 469 539 4.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 469 539 4.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 469 541 4.0E-06
sp|Q8NAP3|ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens GN=ZBTB38 PE=1 SV=2 448 544 4.0E-06
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 470 540 4.0E-06
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 469 541 4.0E-06
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 471 540 4.0E-06
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 470 541 4.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 471 540 4.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 470 540 4.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 470 540 4.0E-06
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 470 541 4.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 469 539 5.0E-06
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 470 541 5.0E-06
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 459 517 5.0E-06
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 471 540 5.0E-06
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 472 541 5.0E-06
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 541 5.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 470 539 5.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 441 541 5.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 471 541 5.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 469 541 5.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 469 540 5.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 450 539 5.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 470 542 5.0E-06
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 471 539 5.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 470 541 5.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 470 541 5.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 470 541 5.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 540 5.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 541 5.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 469 541 5.0E-06
sp|Q80V63|PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus GN=Prdm4 PE=2 SV=2 471 539 5.0E-06
sp|Q9QZP2|PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus GN=Prdm4 PE=2 SV=1 471 539 5.0E-06
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 459 540 5.0E-06
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 459 540 5.0E-06
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 454 539 5.0E-06
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 469 540 5.0E-06
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 442 523 5.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 453 541 5.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 470 541 5.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 471 539 5.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 541 5.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 469 541 5.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 471 540 5.0E-06
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 467 540 5.0E-06
sp|A6QNZ0|ZSC26_BOVIN Zinc finger and SCAN domain-containing protein 26 OS=Bos taurus GN=ZSCAN26 PE=2 SV=1 466 539 5.0E-06
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 470 541 5.0E-06
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 469 541 5.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 540 5.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 470 539 5.0E-06
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 459 539 5.0E-06
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 469 539 5.0E-06
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 469 540 5.0E-06
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 472 540 5.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 459 541 5.0E-06
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 469 530 5.0E-06
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 469 540 5.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 459 541 5.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 471 541 5.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 471 516 6.0E-06
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 469 539 6.0E-06
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 470 539 6.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 470 539 6.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 466 517 6.0E-06
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 459 530 6.0E-06
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 471 539 6.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 471 539 6.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 459 541 6.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 469 540 6.0E-06
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 469 541 6.0E-06
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 469 541 6.0E-06
sp|P51502|ZNF80_CHLAE Zinc finger protein 80 OS=Chlorocebus aethiops GN=ZNF80 PE=3 SV=1 469 541 6.0E-06
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 471 539 6.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 468 539 6.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 471 539 6.0E-06
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 471 541 6.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 470 539 6.0E-06
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 470 539 6.0E-06
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 470 541 6.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 470 541 6.0E-06
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 471 539 6.0E-06
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 471 539 6.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 470 541 6.0E-06
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 459 541 6.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 425 541 6.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 470 539 6.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 455 541 6.0E-06
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 469 541 6.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 469 586 6.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 470 541 6.0E-06
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 471 540 6.0E-06
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 469 541 6.0E-06
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 470 539 7.0E-06
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 470 539 7.0E-06
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 464 520 7.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 470 540 7.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 540 7.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 470 539 7.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 469 532 7.0E-06
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 470 539 7.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 7.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 540 7.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 467 540 7.0E-06
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 470 541 7.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 471 539 7.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 470 541 7.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 470 542 7.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 470 541 7.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 471 541 7.0E-06
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 471 541 7.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 540 7.0E-06
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 470 540 7.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 470 541 7.0E-06
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 454 541 7.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 470 539 7.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 471 541 8.0E-06
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 471 539 8.0E-06
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 464 520 8.0E-06
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 455 539 8.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 470 539 8.0E-06
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 467 541 8.0E-06
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 450 540 8.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 470 544 8.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 469 540 8.0E-06
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 471 541 8.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 470 539 8.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 469 540 8.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 469 539 8.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 470 541 8.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 470 541 8.0E-06
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 472 541 8.0E-06
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 467 541 8.0E-06
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 464 539 8.0E-06
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 464 539 8.0E-06
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 464 539 8.0E-06
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 464 539 8.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 470 541 8.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 470 541 8.0E-06
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 464 540 8.0E-06
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 471 548 8.0E-06
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 471 517 9.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 470 540 9.0E-06
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 470 541 9.0E-06
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 470 541 9.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 455 539 9.0E-06
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 455 539 9.0E-06
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 469 540 9.0E-06
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 475 541 9.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 469 540 9.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 470 539 9.0E-06
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 470 541 9.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 455 541 9.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 459 541 9.0E-06
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 467 541 9.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 470 541 9.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 466 541 9.0E-06
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 469 541 9.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 471 539 9.0E-06
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 470 539 1.0E-05
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 471 539 1.0E-05
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 459 541 1.0E-05
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 470 541 1.0E-05
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 470 540 1.0E-05
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 464 541 1.0E-05
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 470 539 1.0E-05
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 470 539 1.0E-05
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 469 541 1.0E-05
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 469 539 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9785
LREFRTKRFPSTTTSTDDNGPPSELLLRRYANSTPSAFEGVKIPTLPNANQQRQAAGHRRGLSLDTRRQQTASPT
TRQDYKQQRIQACPGTPQHQQRHLQQPPQHYHSLASSEGDSYLVSPHSTPQTHRFDPASCFDTGPVPFDPYGAAQ
LSLMMQKNQESYASNMGEAKEFDLFTNDSDLSTPTFVNFPDSPSGQSWPAEDGRRRSSRRISNGIVERVNKYENL
GMEGLQRPMTPPNQNANSYFPPTPMETPHDRIIKPEPRPDRFHDDYDESMEETIKPIRNRSNQRAHNIFHEMRQQ
AERSPAEPSPPRSGRPPNAKTFGRLQMHPPDCLDMNALRSEFAKMEGGFDGQVFEGDGLGHGPDLPPHRSPADGQ
LAAGHFLGGFDDKPDLQPFHGSSQAMGGPESTCPSGRASPHRRTESVASIASAASIASINIEETKTETGVTTEEI
AQYIRSPETTDGKWTCLFEDCGKKFGRKENIKSHVQTHLNDRQYQCPTCKKCFVRQHDLKRHAKIHTGIKPYPCE
CGNSFARHDALTRHRQRGMCIGAFDGIVRKVVKRGRPRKNRPDMETRMEKSARQRRKDMSMSSASSVSGYSDSSA
ANSPDNDYNMLDDVVDVAVDKGGSLSSAPMPTSVMPPRTTYEAAYEAAASPSAASVHSYVSPEAIMEKTLSNPAT
PARSVASHYTTPPELSQSSSPPAAPFFDADFGASAGSDTMAAVMASTAGMASTAGMASTAGMASTAAMAETMPVG
IGDQDEDLLLQFTNDDGLAQMDRESSMLMMTKFDEEFENVGMFSSDDMFFGGGS*
Coding >Hirsu2|9785
CTGCGTGAGTTTCGGACCAAACGGTTCCCATCGACAACGACCTCGACCGACGACAACGGCCCCCCTTCCGAACTC
CTCTTGCGACGATATGCTAACTCGACACCCTCTGCCTTCGAGGGCGTGAAGATCCCGACCCTGCCCAACGCCAAC
CAGCAACGGCAGGCCGCCGGCCACCGCCGCGGCCTGAGCCTCGACACGCGACGACAACAGACGGCGTCCCCGACC
ACGCGGCAGGACTACAAGCAGCAACGCATACAAGCATGCCCGGGCACCCCCCAACACCAGCAGCGGCACCTCCAG
CAGCCGCCGCAGCACTACCACTCACTAGCATCCAGCGAGGGCGACAGCTACCTTGTCTCCCCCCACAGCACGCCG
CAGACTCACCGCTTCGACCCTGCCTCGTGTTTCGACACGGGCCCTGTGCCCTTCGACCCGTACGGGGCGGCACAG
CTGAGCCTGATGATGCAGAAGAACCAGGAGAGTTACGCGAGCAACATGGGCGAGGCTAAGGAGTTCGACCTCTTC
ACCAACGACAGCGACCTCTCCACGCCGACCTTTGTCAACTTCCCCGACAGCCCCTCCGGCCAGAGCTGGCCGGCC
GAAGACGGCCGGCGGCGGTCGTCGAGGAGGATCAGCAACGGCATCGTGGAGCGGGTGAACAAGTACGAGAACTTG
GGAATGGAGGGCCTGCAGAGGCCGATGACACCCCCGAACCAGAATGCGAACAGTTATTTCCCCCCAACGCCGATG
GAGACGCCTCACGACCGCATCATCAAGCCAGAGCCGCGGCCGGACCGGTTTCACGACGACTATGACGAGTCGATG
GAGGAAACGATCAAGCCCATCCGCAACCGCTCCAACCAGCGCGCCCACAACATCTTCCACGAGATGCGGCAACAG
GCCGAGAGAAGCCCTGCGGAACCGAGCCCGCCTCGGTCGGGCCGGCCGCCCAACGCCAAGACGTTCGGCAGGCTG
CAGATGCACCCGCCCGACTGCCTCGACATGAACGCTCTTCGCAGCGAGTTTGCCAAGATGGAGGGCGGATTCGAC
GGCCAGGTGTTCGAGGGAGACGGCCTGGGCCACGGCCCGGACCTGCCGCCGCACCGCTCGCCGGCCGACGGGCAG
CTCGCTGCCGGCCACTTCTTGGGGGGGTTCGACGACAAGCCCGACCTGCAGCCTTTCCACGGCTCGTCGCAGGCC
ATGGGCGGGCCCGAGTCGACGTGTCCGTCGGGGAGGGCGTCGCCGCATCGGCGGACCGAGTCGGTGGCCAGCATC
GCCAGCGCCGCCAGCATCGCCAGCATCAATATCGAGGAGACCAAGACGGAGACGGGGGTGACGACGGAGGAGATT
GCACAGTACATCCGCAGCCCCGAGACGACCGACGGCAAGTGGACCTGTCTCTTCGAGGACTGCGGCAAGAAGTTT
GGGCGCAAGGAGAACATCAAGTCGCACGTGCAGACGCACCTCAACGACCGGCAGTACCAGTGCCCGACGTGCAAG
AAGTGCTTCGTGCGGCAGCACGACCTGAAGCGGCACGCCAAGATCCACACCGGCATCAAGCCGTACCCGTGCGAG
TGCGGCAACAGCTTCGCCCGGCATGACGCCCTGACGAGACACCGGCAGCGGGGGATGTGCATCGGGGCCTTTGAC
GGCATCGTGCGCAAGGTGGTCAAGCGCGGGCGGCCGCGCAAAAACCGACCCGACATGGAGACGAGGATGGAGAAG
TCGGCGCGGCAGCGGAGGAAGGACATGTCGATGAGCTCGGCCTCGTCCGTGTCGGGCTACTCGGACAGCTCGGCC
GCCAACTCGCCGGACAACGACTACAACATGCTGGACGACGTGGTCGACGTGGCCGTCGACAAGGGCGGGTCGCTG
TCGTCGGCGCCGATGCCGACGTCGGTGATGCCGCCGCGGACGACCTACGAGGCGGCCTACGAGGCGGCCGCGTCG
CCGTCGGCCGCCAGCGTCCACTCGTACGTGTCGCCCGAGGCCATCATGGAGAAGACGTTGTCGAACCCGGCGACG
CCGGCCCGGAGCGTTGCGAGCCACTACACGACGCCGCCTGAGCTGTCGCAGTCGTCTTCGCCGCCGGCCGCTCCC
TTCTTCGACGCCGACTTCGGCGCCTCGGCCGGCTCCGACACCATGGCGGCCGTCATGGCGTCGACGGCGGGCATG
GCATCGACGGCGGGCATGGCGTCGACGGCGGGCATGGCGTCGACGGCGGCTATGGCCGAGACGATGCCCGTCGGC
ATCGGCGACCAGGACGAGGACCTGCTGCTTCAGTTCACCAATGACGACGGCCTCGCGCAGATGGACCGCGAGTCG
AGCATGCTGATGATGACCAAGTTCGACGAGGAATTCGAAAACGTCGGCATGTTCAGCAGCGACGATATGTTCTTT
GGCGGCGGCTCGTGA
Transcript >Hirsu2|9785
CTGCGTGAGTTTCGGACCAAACGGTTCCCATCGACAACGACCTCGACCGACGACAACGGCCCCCCTTCCGAACTC
CTCTTGCGACGATATGCTAACTCGACACCCTCTGCCTTCGAGGGCGTGAAGATCCCGACCCTGCCCAACGCCAAC
CAGCAACGGCAGGCCGCCGGCCACCGCCGCGGCCTGAGCCTCGACACGCGACGACAACAGACGGCGTCCCCGACC
ACGCGGCAGGACTACAAGCAGCAACGCATACAAGCATGCCCGGGCACCCCCCAACACCAGCAGCGGCACCTCCAG
CAGCCGCCGCAGCACTACCACTCACTAGCATCCAGCGAGGGCGACAGCTACCTTGTCTCCCCCCACAGCACGCCG
CAGACTCACCGCTTCGACCCTGCCTCGTGTTTCGACACGGGCCCTGTGCCCTTCGACCCGTACGGGGCGGCACAG
CTGAGCCTGATGATGCAGAAGAACCAGGAGAGTTACGCGAGCAACATGGGCGAGGCTAAGGAGTTCGACCTCTTC
ACCAACGACAGCGACCTCTCCACGCCGACCTTTGTCAACTTCCCCGACAGCCCCTCCGGCCAGAGCTGGCCGGCC
GAAGACGGCCGGCGGCGGTCGTCGAGGAGGATCAGCAACGGCATCGTGGAGCGGGTGAACAAGTACGAGAACTTG
GGAATGGAGGGCCTGCAGAGGCCGATGACACCCCCGAACCAGAATGCGAACAGTTATTTCCCCCCAACGCCGATG
GAGACGCCTCACGACCGCATCATCAAGCCAGAGCCGCGGCCGGACCGGTTTCACGACGACTATGACGAGTCGATG
GAGGAAACGATCAAGCCCATCCGCAACCGCTCCAACCAGCGCGCCCACAACATCTTCCACGAGATGCGGCAACAG
GCCGAGAGAAGCCCTGCGGAACCGAGCCCGCCTCGGTCGGGCCGGCCGCCCAACGCCAAGACGTTCGGCAGGCTG
CAGATGCACCCGCCCGACTGCCTCGACATGAACGCTCTTCGCAGCGAGTTTGCCAAGATGGAGGGCGGATTCGAC
GGCCAGGTGTTCGAGGGAGACGGCCTGGGCCACGGCCCGGACCTGCCGCCGCACCGCTCGCCGGCCGACGGGCAG
CTCGCTGCCGGCCACTTCTTGGGGGGGTTCGACGACAAGCCCGACCTGCAGCCTTTCCACGGCTCGTCGCAGGCC
ATGGGCGGGCCCGAGTCGACGTGTCCGTCGGGGAGGGCGTCGCCGCATCGGCGGACCGAGTCGGTGGCCAGCATC
GCCAGCGCCGCCAGCATCGCCAGCATCAATATCGAGGAGACCAAGACGGAGACGGGGGTGACGACGGAGGAGATT
GCACAGTACATCCGCAGCCCCGAGACGACCGACGGCAAGTGGACCTGTCTCTTCGAGGACTGCGGCAAGAAGTTT
GGGCGCAAGGAGAACATCAAGTCGCACGTGCAGACGCACCTCAACGACCGGCAGTACCAGTGCCCGACGTGCAAG
AAGTGCTTCGTGCGGCAGCACGACCTGAAGCGGCACGCCAAGATCCACACCGGCATCAAGCCGTACCCGTGCGAG
TGCGGCAACAGCTTCGCCCGGCATGACGCCCTGACGAGACACCGGCAGCGGGGGATGTGCATCGGGGCCTTTGAC
GGCATCGTGCGCAAGGTGGTCAAGCGCGGGCGGCCGCGCAAAAACCGACCCGACATGGAGACGAGGATGGAGAAG
TCGGCGCGGCAGCGGAGGAAGGACATGTCGATGAGCTCGGCCTCGTCCGTGTCGGGCTACTCGGACAGCTCGGCC
GCCAACTCGCCGGACAACGACTACAACATGCTGGACGACGTGGTCGACGTGGCCGTCGACAAGGGCGGGTCGCTG
TCGTCGGCGCCGATGCCGACGTCGGTGATGCCGCCGCGGACGACCTACGAGGCGGCCTACGAGGCGGCCGCGTCG
CCGTCGGCCGCCAGCGTCCACTCGTACGTGTCGCCCGAGGCCATCATGGAGAAGACGTTGTCGAACCCGGCGACG
CCGGCCCGGAGCGTTGCGAGCCACTACACGACGCCGCCTGAGCTGTCGCAGTCGTCTTCGCCGCCGGCCGCTCCC
TTCTTCGACGCCGACTTCGGCGCCTCGGCCGGCTCCGACACCATGGCGGCCGTCATGGCGTCGACGGCGGGCATG
GCATCGACGGCGGGCATGGCGTCGACGGCGGGCATGGCGTCGACGGCGGCTATGGCCGAGACGATGCCCGTCGGC
ATCGGCGACCAGGACGAGGACCTGCTGCTTCAGTTCACCAATGACGACGGCCTCGCGCAGATGGACCGCGAGTCG
AGCATGCTGATGATGACCAAGTTCGACGAGGAATTCGAAAACGTCGGCATGTTCAGCAGCGACGATATGTTCTTT
GGCGGCGGCTCGTGA
Gene >Hirsu2|9785
CTGCGTGAGGTGAGTCGCCGCGCCATGGCCGACTGGAAGCTGGAAGGCATCCTGACGAGGTCGGTCGCACAACAG
TTTCGGACCAAACGGTTCCCATCGACAACGACCTCGACCGACGACAACGGCCCCCCTTCCGAACTCCTCTTGCGA
CGATATGCTGTCCAATCCGACGACAAGTCTTCACGCCAGGCAGAGGCAACACCGCCGCCAGAACTCGACACCCTC
TGCCTTCGAGGGCGTGAAGATCCCGACCCTGCCCAACGCCAACCAGCAACGGCAGGCCGCCGGCCACCGCCGCGG
CCTGAGCCTCGACACGCGACGACAACAGACGGCGTCCCCGACCACGCGGCAGGACTACAAGGTAAGCATGAGTAC
TAACGCCTCCGGATTAGCACCCAATTCGCAGCATCCCGTTCTGCGAGAAGCGCAGCAGCAACGCATACAAGCATG
CCCGGGCACCCCCCAACACCAGCAGCGGCACCTCCAGCAGCCGCCGCAGCACTACCACTCACTAGCATCCAGCGA
GGGCGACAGCTACCTTGTCTCCCCCCACAGCACGCCGCAGACTCACCGCTTCGACCCTGCCTCGTGTTTCGACAC
GGGCCCTGTGCCCTTCGACCCGTACGGGGCGGCACAGCTGAGCCTGATGATGCAGAAGAACCAGGAGAGTTACGC
GAGCAACATGGGCGAGGCTAAGGAGTTCGACCTCTTCACCAACGACAGCGACCTCTCCACGCCGACCTTTGTCAA
CTTCCCCGACAGCCCCTCCGGCCAGAGCTGGCCGGCCGAAGACGGCCGGCGGCGGTCGTCGAGGAGGATCAGCAA
CGGCATCGTGGAGCGGGTGAACAAGTACGAGAACTTGGGAATGGAGGGCCTGCAGAGGCCGATGACACCCCCGAA
CCAGAATGCGAACAGTAAGTGCCGGTCTGCCGTCCTCGCCGTCATTGCCCGCAGCTCTCTGACCAGAGACGGGCA
GGTTATTTCCCCCCAACGCCGATGGAGACGCCTCACGACCGCATCATCAAGCCAGAGCCGCGGCCGGACCGGTTT
CACGACGACTATGACGAGTCGATGGAGGAAACGATCAAGCCCATCCGCAACCGCTCCAACCAGCGCGCCCACAAC
ATCTTCCACGAGATGCGGCAACAGGCCGAGAGAAGCCCTGCGGAACCGAGCCCGCCTCGGTCGGGCCGGCCGCCC
AACGCCAAGACGTTCGGCAGGCTGCAGATGCACCCGCCCGACTGCCTCGACATGAACGCTCTTCGCAGCGAGTTT
GCCAAGATGGAGGGCGGATTCGACGGCCAGGTGTTCGAGGGAGACGGCCTGGGCCACGGCCCGGACCTGCCGCCG
CACCGCTCGCCGGCCGACGGGCAGCTCGCTGCCGGCCACTTCTTGGGGGGGTTCGACGACAAGCCCGACCTGCAG
CCTTTCCACGGCTCGTCGCAGGCCATGGGCGGGCCCGAGTCGACGTGTCCGTCGGGGAGGGCGTCGCCGCATCGG
CGGACCGAGTCGGTGGCCAGCATCGCCAGCGCCGCCAGCATCGCCAGCATCAATATCGAGGAGACCAAGACGGAG
ACGGGGGTGACGACGGAGGAGATTGCACAGTACATCCGCAGCCCCGAGACGACCGACGGCAAGTGGACCTGTCTC
TTCGAGGACTGCGGCAAGAAGTTTGGGCGCAAGGAGAACATCAAGTCGCACGTGCAGACGCACCTCAACGACCGG
CAGTACCAGTGCCCGACGTGCAAGAAGTGCTTCGTGCGGCAGCACGACCTGAAGCGGCACGCCAAGATCCACACC
GGCATCAAGCCGTACCCGTGCGAGTGCGGCAACAGCTTCGCCCGGCATGACGCCCTGACGAGACACCGGCAGCGG
GGGATGTGCATCGGGGCCTTTGACGGCATCGTGCGCAAGGTGGTCAAGCGCGGGCGGCCGCGCAAAAACCGACCC
GACATGGAGACGAGGATGGAGAAGTCGGCGCGGCAGCGGAGGAAGGACATGTCGATGAGCTCGGCCTCGTCCGTG
TCGGGCTACTCGGACAGCTCGGCCGCCAACTCGCCGGACAACGACTACAACATGCTGGACGACGTGGTCGACGTG
GCCGTCGACAAGGGCGGGTCGCTGTCGTCGGCGCCGATGCCGACGTCGGTGATGCCGCCGCGGACGACCTACGAG
GCGGCCTACGAGGCGGCCGCGTCGCCGTCGGCCGCCAGCGTCCACTCGTACGTGTCGCCCGAGGCCATCATGGAG
AAGACGTTGTCGAACCCGGCGACGCCGGCCCGGAGCGTTGCGAGCCACTACACGACGCCGCCTGAGCTGTCGCAG
TCGTCTTCGCCGCCGGCCGCTCCCTTCTTCGACGCCGACTTCGGCGCCTCGGCCGGCTCCGACACCATGGCGGCC
GTCATGGCGTCGACGGCGGGCATGGCATCGACGGCGGGCATGGCGTCGACGGCGGGCATGGCGTCGACGGCGGCT
ATGGCCGAGACGATGCCCGTCGGCATCGGCGACCAGGACGAGGACCTGCTGCTTCAGTTCACCAATGACGACGGC
CTCGCGCAGATGGACCGCGAGTCGAGCATGCTGATGATGACCAAGTTCGACGAGGAATTCGAAAACGTCGGCATG
TTCAGCAGCGACGATATGTTCTTTGGCGGCGGCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail