Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9784
Gene name
LocationContig_738:4612..6795
Strand-
Gene length (bp)2183
Transcript length (bp)2040
Coding sequence length (bp)2040
Protein length (aa) 680

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00571 CBS CBS domain 4.6E-07 106 150
PF00571 CBS CBS domain 1.1E-08 163 208
PF00571 CBS CBS domain 6.1E-05 273 317
PF00571 CBS CBS domain 1.7E-05 333 377
PF00564 PB1 PB1 domain 4.7E-08 483 578

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13965|MUG70_SCHPO Meiotically up-regulated gene 70 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug70 PE=1 SV=1 41 388 5.0E-78
sp|Q9LF97|Y3295_ARATH CBS domain-containing protein CBSCBSPB3 OS=Arabidopsis thaliana GN=CBSCBSPB3 PE=1 SV=1 95 565 5.0E-70
sp|Q9SJQ5|Y2650_ARATH CBS domain-containing protein CBSCBSPB2 OS=Arabidopsis thaliana GN=CBSCBSPB2 PE=2 SV=1 95 565 4.0E-63
sp|P0DH79|Y5064_ARATH CBS domain-containing protein CBSCBSPB5 OS=Arabidopsis thaliana GN=CBSCBSPB5 PE=1 SV=1 95 561 4.0E-58
sp|Q0WLC7|Y5053_ARATH CBS domain-containing protein CBSCBSPB4 OS=Arabidopsis thaliana GN=CBSCBSPB4 PE=1 SV=2 95 561 4.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13965|MUG70_SCHPO Meiotically up-regulated gene 70 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug70 PE=1 SV=1 41 388 5.0E-78
sp|Q9LF97|Y3295_ARATH CBS domain-containing protein CBSCBSPB3 OS=Arabidopsis thaliana GN=CBSCBSPB3 PE=1 SV=1 95 565 5.0E-70
sp|Q9SJQ5|Y2650_ARATH CBS domain-containing protein CBSCBSPB2 OS=Arabidopsis thaliana GN=CBSCBSPB2 PE=2 SV=1 95 565 4.0E-63
sp|P0DH79|Y5064_ARATH CBS domain-containing protein CBSCBSPB5 OS=Arabidopsis thaliana GN=CBSCBSPB5 PE=1 SV=1 95 561 4.0E-58
sp|Q0WLC7|Y5053_ARATH CBS domain-containing protein CBSCBSPB4 OS=Arabidopsis thaliana GN=CBSCBSPB4 PE=1 SV=2 95 561 4.0E-58
sp|Q9FMV3|Y5349_ARATH CBS domain-containing protein CBSCBSPB1 OS=Arabidopsis thaliana GN=CBSCBSPB1 PE=1 SV=1 95 578 3.0E-48
sp|P32987|YBP3_ACIAM Uncharacterized 17.7 kDa protein in bps2 3'region OS=Acidianus ambivalens PE=3 SV=1 107 209 2.0E-12
sp|P50100|Y525_METKA Uncharacterized protein MK0525 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0525 PE=3 SV=2 109 209 2.0E-08
sp|O13965|MUG70_SCHPO Meiotically up-regulated gene 70 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug70 PE=1 SV=1 421 596 6.0E-08
sp|Q58069|Y653_METJA Uncharacterized protein MJ0653 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0653 PE=3 SV=1 273 387 2.0E-06
sp|Q8Z4C7|GUTQ_SALTI Arabinose 5-phosphate isomerase GutQ OS=Salmonella typhi GN=gutQ PE=3 SV=1 106 216 3.0E-06
sp|Q8ZMJ9|GUTQ_SALTY Arabinose 5-phosphate isomerase GutQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gutQ PE=3 SV=2 106 216 3.0E-06
sp|Q49729|IMDH_MYCLE Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=guaB PE=3 SV=1 108 240 5.0E-06
sp|P54606|YHCV_BACSU CBS domain-containing protein YhcV OS=Bacillus subtilis (strain 168) GN=yhcV PE=3 SV=1 276 397 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 655 674 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9784
MSGNTIRGTPNRGQNRGSIPFGNSPAAAAGGAGGSGIPRPVFDNQPAESSSSVSASRQKQSKRDEAIRRKMENDL
QKKKHLTSRARHTRKAPPGTVLALKPSPALQIKPATTVAEAAQLMAAKREDCVLVTDDDDRIAGIFTAKDLAFRV
VGAGSKAANVTIAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEKLERAYS
SSRKLYDALEGVHSELGATQPQQIIQYVEALRSKMSGPTLESVLNGVPPTTVSVRTSVKEAAALMKENHTTAVLV
QDQGAITGIFTSKDVVLRVIAPGLDPANCSVVRVMTPHPDFAPMDMTIQAALRKMHDGHYLNLPVMNDSGEIVGM
VDVLKLTYATLEQINTMSSGDAEGPAWNKFWLSIDNETESIMSGEGSHSHHHTNLSSRMMSPDATRERMGDSVAP
GDSASHVGAESPTRSMIPETPEPTNPADTPFPFKFKAPSGRVHRLQIVASNGLDAFVASVAAKLGNEVDAIGGTP
TVDEGKMSGCGFAVSYMDDEGDTVSITTDNDLVEAVVLARQRHREKVDLFVHDSDKPPVSALAAAADTSAIPTPP
ASSAPGLRERRKFYEDEEEEEEEEDDDDSAVRRSRRTRTARAPEQLIAGVPNELLLPGAIVTLAVVIVGVFTIAR
ATSR*
Coding >Hirsu2|9784
ATGTCTGGAAACACGATCCGGGGCACGCCCAACCGCGGCCAGAACCGCGGCAGCATCCCCTTCGGCAACAGTCCT
GCTGCGGCAGCTGGAGGAGCTGGGGGATCTGGCATTCCTCGTCCTGTCTTCGACAACCAGCCTGCCGAGTCGAGT
TCCTCGGTCAGCGCCAGCCGGCAGAAGCAGTCCAAACGCGATGAGGCCATTCGGCGGAAGATGGAGAATGATCTT
CAGAAGAAGAAGCACCTCACAAGCCGCGCCCGCCACACCCGCAAAGCCCCCCCGGGCACCGTCCTCGCCCTGAAG
CCCAGCCCGGCGCTGCAGATCAAGCCGGCCACGACGGTCGCCGAGGCGGCCCAGCTCATGGCGGCCAAGCGCGAG
GACTGTGTTCTCGTCACCGACGACGACGACAGGATCGCCGGCATCTTCACCGCCAAGGACTTAGCCTTCCGTGTC
GTCGGGGCTGGCTCCAAGGCCGCCAACGTCACCATCGCCGAGATCATGACCAAGAACCCGCTGTGTGCCCGGACC
GACACCAGCGCGACCGACGCCCTGGACCTGATGGTTCGCAAGGGCTTCCGCCACCTGCCCGTCATGGACGAGAAC
CAGGACATATCTGGTGTTCTCGACATCACAAAGTGCTTCTACGACGCCATGGAGAAGCTCGAGCGCGCCTATTCT
TCCTCGAGGAAGCTCTACGACGCGCTCGAGGGCGTCCACTCCGAGCTCGGTGCCACCCAGCCCCAGCAGATCATC
CAGTACGTCGAGGCTCTCCGCTCCAAGATGTCGGGGCCGACGCTCGAGTCCGTCCTCAACGGCGTGCCCCCCACC
ACCGTCAGCGTGCGGACCTCGGTCAAGGAGGCTGCTGCTCTGATGAAGGAGAACCACACGACGGCCGTGCTGGTG
CAGGACCAAGGTGCCATCACCGGAATCTTCACCAGCAAGGACGTCGTCCTTCGCGTCATCGCCCCGGGTCTCGAT
CCCGCCAACTGCAGCGTCGTCCGTGTCATGACGCCTCACCCAGACTTTGCTCCCATGGACATGACCATCCAAGCC
GCTCTCCGCAAAATGCACGATGGCCACTACCTCAACCTGCCGGTCATGAATGATAGCGGCGAAATTGTCGGCATG
GTCGACGTTCTCAAGCTCACATACGCCACCCTGGAGCAGATCAACACCATGTCGAGCGGCGATGCGGAGGGTCCT
GCCTGGAACAAGTTCTGGCTGTCGATCGACAACGAGACCGAGTCGATCATGTCTGGCGAGGGCAGCCACAGCCAC
CACCACACCAACCTCAGCTCTCGCATGATGTCGCCGGATGCGACGCGTGAGCGCATGGGGGACAGTGTCGCCCCT
GGCGACTCTGCCTCCCACGTTGGGGCCGAGTCGCCTACCCGCTCCATGATCCCCGAGACGCCCGAGCCTACGAAC
CCCGCCGACACGCCGTTCCCGTTCAAGTTCAAGGCGCCCTCGGGACGTGTCCACCGGCTACAGATTGTGGCTTCC
AACGGCCTAGATGCATTTGTCGCCTCCGTGGCCGCCAAGCTCGGCAATGAAGTGGATGCCATCGGTGGCACGCCG
ACCGTCGACGAGGGCAAGATGAGCGGCTGCGGCTTTGCCGTCAGCTACATGGACGACGAGGGCGACACTGTCTCC
ATCACCACCGACAACGACCTCGTCGAGGCCGTCGTGCTCGCGCGACAGCGCCATCGTGAAAAGGTGGACCTCTTC
GTCCACGACTCGGATAAACCACCCGTCTCGGCTCTGGCAGCGGCGGCGGACACGTCTGCGATCCCGACACCCCCC
GCCTCCTCTGCGCCTGGCCTGCGCGAACGCCGGAAGTTCTACGAGGACGAGGAAGAGGAGGAGGAGGAGGAGGAC
GACGACGACTCTGCTGTCCGTCGCTCTCGGAGAACACGGACCGCCCGTGCTCCGGAACAGCTCATCGCCGGCGTG
CCGAACGAGCTGCTCCTCCCCGGCGCGATTGTCACGCTGGCAGTAGTCATTGTCGGCGTGTTCACCATAGCCCGC
GCGACCAGCCGGTAA
Transcript >Hirsu2|9784
ATGTCTGGAAACACGATCCGGGGCACGCCCAACCGCGGCCAGAACCGCGGCAGCATCCCCTTCGGCAACAGTCCT
GCTGCGGCAGCTGGAGGAGCTGGGGGATCTGGCATTCCTCGTCCTGTCTTCGACAACCAGCCTGCCGAGTCGAGT
TCCTCGGTCAGCGCCAGCCGGCAGAAGCAGTCCAAACGCGATGAGGCCATTCGGCGGAAGATGGAGAATGATCTT
CAGAAGAAGAAGCACCTCACAAGCCGCGCCCGCCACACCCGCAAAGCCCCCCCGGGCACCGTCCTCGCCCTGAAG
CCCAGCCCGGCGCTGCAGATCAAGCCGGCCACGACGGTCGCCGAGGCGGCCCAGCTCATGGCGGCCAAGCGCGAG
GACTGTGTTCTCGTCACCGACGACGACGACAGGATCGCCGGCATCTTCACCGCCAAGGACTTAGCCTTCCGTGTC
GTCGGGGCTGGCTCCAAGGCCGCCAACGTCACCATCGCCGAGATCATGACCAAGAACCCGCTGTGTGCCCGGACC
GACACCAGCGCGACCGACGCCCTGGACCTGATGGTTCGCAAGGGCTTCCGCCACCTGCCCGTCATGGACGAGAAC
CAGGACATATCTGGTGTTCTCGACATCACAAAGTGCTTCTACGACGCCATGGAGAAGCTCGAGCGCGCCTATTCT
TCCTCGAGGAAGCTCTACGACGCGCTCGAGGGCGTCCACTCCGAGCTCGGTGCCACCCAGCCCCAGCAGATCATC
CAGTACGTCGAGGCTCTCCGCTCCAAGATGTCGGGGCCGACGCTCGAGTCCGTCCTCAACGGCGTGCCCCCCACC
ACCGTCAGCGTGCGGACCTCGGTCAAGGAGGCTGCTGCTCTGATGAAGGAGAACCACACGACGGCCGTGCTGGTG
CAGGACCAAGGTGCCATCACCGGAATCTTCACCAGCAAGGACGTCGTCCTTCGCGTCATCGCCCCGGGTCTCGAT
CCCGCCAACTGCAGCGTCGTCCGTGTCATGACGCCTCACCCAGACTTTGCTCCCATGGACATGACCATCCAAGCC
GCTCTCCGCAAAATGCACGATGGCCACTACCTCAACCTGCCGGTCATGAATGATAGCGGCGAAATTGTCGGCATG
GTCGACGTTCTCAAGCTCACATACGCCACCCTGGAGCAGATCAACACCATGTCGAGCGGCGATGCGGAGGGTCCT
GCCTGGAACAAGTTCTGGCTGTCGATCGACAACGAGACCGAGTCGATCATGTCTGGCGAGGGCAGCCACAGCCAC
CACCACACCAACCTCAGCTCTCGCATGATGTCGCCGGATGCGACGCGTGAGCGCATGGGGGACAGTGTCGCCCCT
GGCGACTCTGCCTCCCACGTTGGGGCCGAGTCGCCTACCCGCTCCATGATCCCCGAGACGCCCGAGCCTACGAAC
CCCGCCGACACGCCGTTCCCGTTCAAGTTCAAGGCGCCCTCGGGACGTGTCCACCGGCTACAGATTGTGGCTTCC
AACGGCCTAGATGCATTTGTCGCCTCCGTGGCCGCCAAGCTCGGCAATGAAGTGGATGCCATCGGTGGCACGCCG
ACCGTCGACGAGGGCAAGATGAGCGGCTGCGGCTTTGCCGTCAGCTACATGGACGACGAGGGCGACACTGTCTCC
ATCACCACCGACAACGACCTCGTCGAGGCCGTCGTGCTCGCGCGACAGCGCCATCGTGAAAAGGTGGACCTCTTC
GTCCACGACTCGGATAAACCACCCGTCTCGGCTCTGGCAGCGGCGGCGGACACGTCTGCGATCCCGACACCCCCC
GCCTCCTCTGCGCCTGGCCTGCGCGAACGCCGGAAGTTCTACGAGGACGAGGAAGAGGAGGAGGAGGAGGAGGAC
GACGACGACTCTGCTGTCCGTCGCTCTCGGAGAACACGGACCGCCCGTGCTCCGGAACAGCTCATCGCCGGCGTG
CCGAACGAGCTGCTCCTCCCCGGCGCGATTGTCACGCTGGCAGTAGTCATTGTCGGCGTGTTCACCATAGCCCGC
GCGACCAGCCGGTAA
Gene >Hirsu2|9784
ATGTCTGGAAACACGATCCGGGGCACGCCCAACCGCGGCCAGAACCGCGGCAGCATCCCCTTCGGCAACAGTCCT
GCTGCGGCAGCTGGAGGAGCTGGGGGATCTGGCATTCCTCGTCCTGTCTTCGACAACCAGCCTGCCGAGTCGAGT
TCCTCGGTCAGCGCCAGCCGGCAGAAGCAGTCCAAACGCGATGAGGTAGGCAGATTGGCGCCCGCCCCGGCCGGA
CGCGGCATCCGAGGCTAACCTGTTGTCGCCGCGGTAGGCCATTCGGCGGAAGATGGAGAATGATCTTCAGAAGAA
GAAGCACCTCACAAGCCGCGCCCGCCACACCCGCAAAGCCCCCCCGGGCACCGTCCTCGCCCTGAAGCCCAGCCC
GGCGCTGCAGATCAAGCCGGCCACGACGGTCGCCGAGGCGGCCCAGCTCATGGCGGCCAAGCGCGAGGACTGTGT
TCTCGTCACCGACGACGACGACAGGATCGCCGGCATCTTCACCGCCAAGGACTTAGCCTTCCGTGTCGTCGGGGC
TGGCTCCAAGGCCGCCAACGTCACCATCGCCGAGATCATGACCAAGAACCCGCTGTGTGCCCGGACCGACACCAG
CGCGACCGACGCCCTGGACCTGATGGTTCGCAAGGGCTTCCGCCACCTGCCCGTCATGGACGAGAACCAGGACAT
ATCTGGTGTTCTCGACATCACAAAGTGCTTCTACGACGCCATGGAGAAGCTCGAGCGCGCCTATTCTTCCTCGAG
GAAGCTCTACGACGCGCTCGAGGGCGTCCACTCCGAGCTCGGTGCCACCCAGCCCCAGCAGATCATCCAGTACGT
CGAGGCTCTCCGCTCCAAGATGTCGGGGCCGACGCTCGAGTCCGTCCTCAACGGCGTGCCCCCCACCACCGTCAG
CGTGCGGACCTCGGTCAAGGAGGCTGCTGCTCTGATGAAGGAGAACCACACGACGGCCGTGCTGGTGCAGGACCA
AGGTGCCATCACCGGAATCTTCACCAGCAAGGACGTCGTCCTTCGCGTCATCGCCCCGGGTCTCGATCCCGCCAA
CTGCAGCGTCGTCCGTGTCATGACGCCTCACCCAGACTTTGCTCCCATGGACATGACCATCCAAGCCGCTCTCCG
CAAAATGCACGGTAGGTACCATTGGAGCTGCGTGCCCTTGTGGCGGGAAGAACTAAGCTGACCTGCGCGCGCCTC
CCCCGTTGACAGATGGCCACTACCTCAACCTGCCGGTCATGAATGATAGCGGCGAAATTGTCGGCATGGTCGACG
TTCTCAAGCTCACATACGCCACCCTGGAGCAGATCAACACCATGTCGAGCGGCGATGCGGAGGGTCCTGCCTGGA
ACAAGTTCTGGCTGTCGATCGACAACGAGACCGAGTCGATCATGTCTGGCGAGGGCAGCCACAGCCACCACCACA
CCAACCTCAGCTCTCGCATGATGTCGCCGGATGCGACGCGTGAGCGCATGGGGGACAGTGTCGCCCCTGGCGACT
CTGCCTCCCACGTTGGGGCCGAGTCGCCTACCCGCTCCATGATCCCCGAGACGCCCGAGCCTACGAACCCCGCCG
ACACGCCGTTCCCGTTCAAGTTCAAGGCGCCCTCGGGACGTGTCCACCGGCTACAGATTGTGGCTTCCAACGGCC
TAGATGCATTTGTCGCCTCCGTGGCCGCCAAGCTCGGCAATGAAGTGGATGCCATCGGTGGCACGCCGACCGTCG
ACGAGGGCAAGATGAGCGGCTGCGGCTTTGCCGTCAGCTACATGGACGACGAGGGCGACACTGTCTCCATCACCA
CCGACAACGACCTCGTCGAGGCCGTCGTGCTCGCGCGACAGCGCCATCGTGAAAAGGTGGACCTCTTCGTCCACG
ACTCGGATAAACCACCCGTCTCGGCTCTGGCAGCGGCGGCGGACACGTCTGCGATCCCGACACCCCCCGCCTCCT
CTGCGCCTGGCCTGCGCGAACGCCGGAAGTTCTACGAGGACGAGGAAGAGGAGGAGGAGGAGGAGGACGACGACG
ACTCTGCTGTCCGTCGCTCTCGGAGAACACGGACCGCCCGTGCTCCGGAACAGCTCATCGCCGGCGTGCCGAACG
AGCTGCTCCTCCCCGGCGCGATTGTCACGCTGGCAGTAGTCATTGTCGGCGTGTTCACCATAGCCCGCGCGACCA
GCCGGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail