Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9771
Gene name
LocationContig_735:600..2321
Strand+
Gene length (bp)1721
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00245 Alk_phosphatase Alkaline phosphatase 2.8E-103 66 511

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11491|PPB_YEAST Repressible alkaline phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO8 PE=1 SV=2 15 544 7.0E-152
sp|O60109|PPB_SCHPO Alkaline phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14F5.13c PE=3 SV=1 1 538 7.0E-137
sp|P19405|PPB3_BACSU Alkaline phosphatase 3 OS=Bacillus subtilis (strain 168) GN=phoB PE=1 SV=4 56 517 4.0E-52
sp|P19406|PPB4_BACSU Alkaline phosphatase 4 OS=Bacillus subtilis (strain 168) GN=phoA PE=1 SV=4 39 502 6.0E-51
sp|Q92058|PPBT_CHICK Alkaline phosphatase, tissue-nonspecific isozyme OS=Gallus gallus GN=ALPL PE=2 SV=1 50 367 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11491|PPB_YEAST Repressible alkaline phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO8 PE=1 SV=2 15 544 7.0E-152
sp|O60109|PPB_SCHPO Alkaline phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14F5.13c PE=3 SV=1 1 538 7.0E-137
sp|P19405|PPB3_BACSU Alkaline phosphatase 3 OS=Bacillus subtilis (strain 168) GN=phoB PE=1 SV=4 56 517 4.0E-52
sp|P19406|PPB4_BACSU Alkaline phosphatase 4 OS=Bacillus subtilis (strain 168) GN=phoA PE=1 SV=4 39 502 6.0E-51
sp|Q92058|PPBT_CHICK Alkaline phosphatase, tissue-nonspecific isozyme OS=Gallus gallus GN=ALPL PE=2 SV=1 50 367 3.0E-31
sp|P08289|PPBT_RAT Alkaline phosphatase, tissue-nonspecific isozyme OS=Rattus norvegicus GN=Alpl PE=1 SV=2 48 367 8.0E-31
sp|P09242|PPBT_MOUSE Alkaline phosphatase, tissue-nonspecific isozyme OS=Mus musculus GN=Alpl PE=1 SV=2 48 367 2.0E-30
sp|P83456|PPB_GADMO Alkaline phosphatase OS=Gadus morhua PE=1 SV=1 50 367 2.0E-30
sp|P21948|PPB_ESCF3 Alkaline phosphatase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=phoA PE=3 SV=1 54 367 2.0E-30
sp|P09487|PPBT_BOVIN Alkaline phosphatase, tissue-nonspecific isozyme OS=Bos taurus GN=ALPL PE=1 SV=2 50 367 8.0E-30
sp|Q24238|APH4_DROME Alkaline phosphatase 4 OS=Drosophila melanogaster GN=Aph4 PE=2 SV=3 55 367 4.0E-29
sp|P05186|PPBT_HUMAN Alkaline phosphatase, tissue-nonspecific isozyme OS=Homo sapiens GN=ALPL PE=1 SV=4 50 367 4.0E-29
sp|P00634|PPB_ECOLI Alkaline phosphatase OS=Escherichia coli (strain K12) GN=phoA PE=1 SV=1 54 367 5.0E-29
sp|P24823|PPBN_MOUSE Alkaline phosphatase, placental-like OS=Mus musculus GN=Alppl2 PE=2 SV=2 63 367 9.0E-29
sp|Q29486|PPBT_FELCA Alkaline phosphatase, tissue-nonspecific isozyme OS=Felis catus GN=ALPL PE=1 SV=1 50 367 2.0E-28
sp|P35483|PPBH_PSEAE Alkaline phosphatase H OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phoA PE=1 SV=2 62 367 3.0E-28
sp|Q02QC9|PPBH_PSEAB Alkaline phosphatase H OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=phoA PE=1 SV=1 62 367 6.0E-28
sp|P29523|PPB_BOMMO Membrane-bound alkaline phosphatase OS=Bombyx mori GN=Alp-m PE=1 SV=4 37 367 2.0E-27
sp|P24822|PPBI_MOUSE Intestinal-type alkaline phosphatase OS=Mus musculus GN=Iap PE=2 SV=1 63 367 3.0E-26
sp|P15693|PPBI1_RAT Intestinal-type alkaline phosphatase 1 OS=Rattus norvegicus GN=Alpi PE=1 SV=1 63 367 2.0E-25
sp|P19111|PPBI_BOVIN Intestinal-type alkaline phosphatase OS=Bos taurus GN=ALPI PE=1 SV=2 63 367 1.0E-24
sp|P10696|PPBN_HUMAN Alkaline phosphatase, placental-like OS=Homo sapiens GN=ALPPL2 PE=2 SV=4 60 367 1.0E-24
sp|P09923|PPBI_HUMAN Intestinal-type alkaline phosphatase OS=Homo sapiens GN=ALPI PE=1 SV=2 67 367 2.0E-24
sp|P51740|PPBI2_RAT Intestinal-type alkaline phosphatase 2 OS=Rattus norvegicus PE=1 SV=1 48 367 5.0E-24
sp|P05187|PPB1_HUMAN Alkaline phosphatase, placental type OS=Homo sapiens GN=ALPP PE=1 SV=2 60 367 7.0E-24
sp|P09401|STRK_STRGR Streptomycin-6-phosphate phosphatase OS=Streptomyces griseus GN=strK PE=3 SV=2 43 367 8.0E-23
sp|P19147|PPB_SERMA Alkaline phosphatase OS=Serratia marcescens GN=phoA PE=3 SV=1 54 367 1.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0016791 phosphatase activity Yes
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9771
MASEHSPLLSSEARDGSNAKRAHRWSRVREIAVFAWALIATAAVIVIAVWTQHNQQTSARASRSAKRNLVFMVSD
GMGPASLSLTRSYRQLVDHLPAHDTLILDRHLSGSSRTRSSNSLVTDSAAGATAFSCGKKSYNGAISVLPDLGPC
GSVLEAAKRAGYMTGLVVTTDITDATPACFASHVLLRGMQDDIALQEIGDGPLGRSVDLILGGGRCHFLPNTTEQ
SCRRDDVDVVRLAQQKFGWSYAHSREGFDALKLGEKADLPLLGLFASTDVPFEIDRKKMDDVYPSLSEMAETALR
ALEKATRHTDRGFFLMIEGSRIDHAGHINDPAAQVREVLEYDKTFGVVLDFLKKSESDGVLVATSDHETGGLSLA
LQEPGHLPMYNWYPQVLANASASCEFLAARLQKHIDEKSSNVSRDDLKAWINDELVVSGLGIADATDDELCRLAD
NPEVSTNTFAAIISLRAHIGWSTHGHSAVDVNIYTSGGPDTDEMRGNVENTDVGKFLSFYLDVDVDDITKELRQK
MEKPAVRATDRPSDRAAHYGLLQ*
Coding >Hirsu2|9771
ATGGCGTCCGAGCACAGTCCCCTGCTCTCCAGCGAAGCCCGCGACGGCAGCAACGCCAAACGTGCCCATCGCTGG
TCTCGCGTCCGCGAGATCGCCGTCTTTGCCTGGGCCCTCATCGCCACCGCCGCCGTCATCGTCATCGCTGTCTGG
ACCCAGCATAACCAGCAAACCTCGGCCCGTGCCTCCCGCTCCGCCAAACGCAATCTTGTCTTTATGGTCTCTGAT
GGCATGGGCCCGGCCTCCCTCTCCCTGACCCGAAGCTACCGCCAGCTCGTCGACCATTTGCCCGCTCATGACACC
CTCATTCTCGACCGGCACCTCTCGGGCTCCAGCCGCACCCGCTCCAGCAACTCTCTCGTTACCGACAGCGCCGCC
GGTGCCACCGCCTTCTCCTGCGGCAAAAAGAGCTACAACGGAGCCATCTCCGTGCTGCCCGACCTCGGACCCTGC
GGCTCTGTCCTCGAGGCCGCCAAGAGAGCCGGGTACATGACGGGCCTCGTCGTCACGACAGACATCACCGATGCC
ACCCCCGCCTGCTTTGCCAGCCATGTCCTGCTGCGCGGTATGCAGGACGATATCGCTCTGCAGGAGATTGGCGAC
GGCCCTCTTGGCCGATCTGTCGACCTTATACTCGGCGGCGGCCGATGCCACTTCCTGCCCAACACCACCGAGCAG
AGCTGCCGCCGCGACGACGTCGACGTCGTCCGCCTGGCTCAGCAGAAATTTGGTTGGAGTTACGCCCACAGCCGC
GAGGGCTTCGATGCCCTCAAGCTTGGCGAGAAGGCCGACCTGCCCTTGCTCGGCCTCTTCGCCTCGACAGACGTA
CCCTTCGAGATCGACCGGAAGAAGATGGACGATGTCTATCCCAGCCTCAGCGAGATGGCCGAGACGGCCCTCCGC
GCCCTGGAAAAGGCCACTCGGCACACTGACCGTGGCTTCTTCCTCATGATTGAGGGCAGCCGCATCGATCACGCC
GGTCACATCAATGACCCCGCTGCACAGGTGCGCGAGGTGCTCGAGTATGACAAGACCTTCGGTGTCGTCTTGGAT
TTTCTCAAGAAGAGCGAGTCCGACGGCGTCCTCGTCGCTACCAGCGACCACGAGACTGGCGGTTTGTCCCTAGCC
CTCCAAGAGCCAGGCCACCTGCCCATGTACAACTGGTACCCCCAGGTTCTCGCCAATGCCTCGGCTTCCTGTGAG
TTCCTCGCCGCTAGGCTACAAAAGCATATCGATGAAAAATCGTCAAATGTGTCGCGTGACGACCTCAAGGCGTGG
ATCAACGACGAATTGGTCGTATCCGGCCTGGGCATCGCCGATGCCACCGACGATGAGCTTTGCCGGCTTGCCGAC
AATCCAGAGGTGTCCACCAACACATTCGCCGCCATTATCTCCCTGCGAGCCCACATCGGCTGGAGCACGCACGGC
CACTCCGCCGTCGACGTCAACATTTACACCTCGGGCGGCCCTGATACTGATGAGATGCGCGGTAACGTAGAAAAC
ACCGACGTCGGCAAGTTTTTGAGCTTCTACCTCGACGTCGACGTCGACGACATCACCAAGGAGCTGAGGCAGAAG
ATGGAGAAGCCTGCTGTCAGGGCAACAGACCGGCCGTCCGATCGAGCAGCGCACTATGGCCTACTGCAATAG
Transcript >Hirsu2|9771
ATGGCGTCCGAGCACAGTCCCCTGCTCTCCAGCGAAGCCCGCGACGGCAGCAACGCCAAACGTGCCCATCGCTGG
TCTCGCGTCCGCGAGATCGCCGTCTTTGCCTGGGCCCTCATCGCCACCGCCGCCGTCATCGTCATCGCTGTCTGG
ACCCAGCATAACCAGCAAACCTCGGCCCGTGCCTCCCGCTCCGCCAAACGCAATCTTGTCTTTATGGTCTCTGAT
GGCATGGGCCCGGCCTCCCTCTCCCTGACCCGAAGCTACCGCCAGCTCGTCGACCATTTGCCCGCTCATGACACC
CTCATTCTCGACCGGCACCTCTCGGGCTCCAGCCGCACCCGCTCCAGCAACTCTCTCGTTACCGACAGCGCCGCC
GGTGCCACCGCCTTCTCCTGCGGCAAAAAGAGCTACAACGGAGCCATCTCCGTGCTGCCCGACCTCGGACCCTGC
GGCTCTGTCCTCGAGGCCGCCAAGAGAGCCGGGTACATGACGGGCCTCGTCGTCACGACAGACATCACCGATGCC
ACCCCCGCCTGCTTTGCCAGCCATGTCCTGCTGCGCGGTATGCAGGACGATATCGCTCTGCAGGAGATTGGCGAC
GGCCCTCTTGGCCGATCTGTCGACCTTATACTCGGCGGCGGCCGATGCCACTTCCTGCCCAACACCACCGAGCAG
AGCTGCCGCCGCGACGACGTCGACGTCGTCCGCCTGGCTCAGCAGAAATTTGGTTGGAGTTACGCCCACAGCCGC
GAGGGCTTCGATGCCCTCAAGCTTGGCGAGAAGGCCGACCTGCCCTTGCTCGGCCTCTTCGCCTCGACAGACGTA
CCCTTCGAGATCGACCGGAAGAAGATGGACGATGTCTATCCCAGCCTCAGCGAGATGGCCGAGACGGCCCTCCGC
GCCCTGGAAAAGGCCACTCGGCACACTGACCGTGGCTTCTTCCTCATGATTGAGGGCAGCCGCATCGATCACGCC
GGTCACATCAATGACCCCGCTGCACAGGTGCGCGAGGTGCTCGAGTATGACAAGACCTTCGGTGTCGTCTTGGAT
TTTCTCAAGAAGAGCGAGTCCGACGGCGTCCTCGTCGCTACCAGCGACCACGAGACTGGCGGTTTGTCCCTAGCC
CTCCAAGAGCCAGGCCACCTGCCCATGTACAACTGGTACCCCCAGGTTCTCGCCAATGCCTCGGCTTCCTGTGAG
TTCCTCGCCGCTAGGCTACAAAAGCATATCGATGAAAAATCGTCAAATGTGTCGCGTGACGACCTCAAGGCGTGG
ATCAACGACGAATTGGTCGTATCCGGCCTGGGCATCGCCGATGCCACCGACGATGAGCTTTGCCGGCTTGCCGAC
AATCCAGAGGTGTCCACCAACACATTCGCCGCCATTATCTCCCTGCGAGCCCACATCGGCTGGAGCACGCACGGC
CACTCCGCCGTCGACGTCAACATTTACACCTCGGGCGGCCCTGATACTGATGAGATGCGCGGTAACGTAGAAAAC
ACCGACGTCGGCAAGTTTTTGAGCTTCTACCTCGACGTCGACGTCGACGACATCACCAAGGAGCTGAGGCAGAAG
ATGGAGAAGCCTGCTGTCAGGGCAACAGACCGGCCGTCCGATCGAGCAGCGCACTATGGCCTACTGCAATAG
Gene >Hirsu2|9771
ATGGTATTCCATCCCATTCCGCGCATAATAATAATTCGTACGCAGCAACCTCACCAGATGAATCCTCAAATCTCC
AGGCGTCCGAGCACAGTCCCCTGCTCTCCAGCGAAGCCCGCGACGGCAGCAACGCCAAACGTGCCCATCGCTGGT
CTCGCGTCCGCGAGATCGCCGTCTTTGCCTGGGCCCTCATCGCCACCGCCGCCGTCATCGTCATCGCTGTCTGGA
CCCAGCATAACCAGCAAACCTCGGCCCGTGCCTCCCGCTCCGCCAAACGCAATCTTGTCTTTATGGTCTCTGATG
GCATGGGCCCGGCCTCCCTCTCCCTGACCCGAAGCTACCGCCAGCTCGTCGACCATTTGCCCGCTCATGACACCC
TCATTCTCGACCGGCACCTCTCGGGCTCCAGCCGCACCCGCTCCAGCAACTCTCTCGTTACCGACAGCGCCGCCG
GTGCCACCGCCTTCTCCTGCGGCAAAAAGAGCTACAACGGAGCCATCTCCGTGCTGCCCGACCTCGGACCCTGCG
GCTCTGTCCTCGAGGCCGCCAAGAGAGCCGGGTACATGACGGGCCTCGTCGTCACGACAGACATCACCGATGCCA
CCCCCGCCTGCTTTGCCAGCCATGTCCTGCTGCGCGGTATGCAGGACGATATCGCTCTGCAGGAGATTGGCGACG
GCCCTCTTGGCCGATCTGTCGACCTTATACTCGGCGGCGGCCGATGCCACTTCCTGCCCAACACCACCGAGCAGA
GCTGCCGCCGCGACGACGTCGACGTCGTCCGCCTGGCTCAGCAGAAATTTGGTTGGAGTTACGCCCACAGCCGCG
AGGGCTTCGATGCCCTCAAGCTTGGCGAGAAGGCCGACCTGCCCTTGCTCGGCCTCTTCGCCTCGACAGACGTAC
CCTTCGAGATCGACCGGAAGAAGATGGACGATGTCTATCCCAGCCTCAGCGAGATGGCCGAGACGGCCCTCCGCG
CCCTGGAAAAGGCCACTCGGCACACTGACCGTGGCTTCTTCCTCATGATTGAGGGCAGCCGCATCGATCACGCCG
GTCACATCAATGACCCCGCTGCACAGGTGCGCGAGGTGCTCGAGTATGACAAGACCTTCGGTGTCGTCTTGGATT
TTCTCAAGAAGAGCGAGTCCGACGGCGTCCTCGTCGCTACCAGCGACCACGAGACTGGCGGTTTGTCCCTAGCCC
TCCAAGAGCCAGGCCACCTGCCCATGTACAACTGGTACCCCCAGGTTCTCGCCAATGCCTCGGCTTCCTGTGAGT
TCCTCGCCGCTAGGCTACAAAAGCATATCGATGAAAAATCGTCAAATGTGTCGCGTGACGACCTCAAGGCGTGGA
TCAACGACGAATTGGTCGTATCCGGCCTGGGCATCGCCGATGCCACCGACGATGAGCTTTGCCGGCTTGCCGACA
ATCCAGAGGTGTCCACCAACACATTCGCCGCCATTATCTCCCTGCGAGCCCACATCGGCTGGAGCACGCACGGCC
ACTCCGCCGTCGACGTCAACATTTACACCTCGGGCGGCCCTGATACTGATGAGATGCGCGGTAACGTAGAAAACA
CCGACGTCGGCAAGTTTTTGAGCTTCTACCTCGACGTCGACGTCGACGACATCACCAAGGAGCTGAGGCAGAAGA
TGGAGAAGCCTGCTGTCAGGGCAACAGACCGGCCGTCCGATCGAGCAGCGCACTATGGCCTACTGCAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail