Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9768
Gene name
LocationContig_734:6079..8326
Strand+
Gene length (bp)2247
Transcript length (bp)1884
Coding sequence length (bp)1884
Protein length (aa) 628

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01425 Amidase Amidase 9.9E-34 185 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FR37|AMI1_ARATH Amidase 1 OS=Arabidopsis thaliana GN=AMI1 PE=1 SV=1 203 604 7.0E-24
sp|B7PDC5|GATA_IXOSC Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ixodes scapularis GN=gatA PE=3 SV=1 202 356 5.0E-20
sp|C4ZHB9|GATA_EUBR3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=gatA PE=3 SV=1 203 357 1.0E-19
sp|Q1J0C2|GATA_DEIGD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus geothermalis (strain DSM 11300) GN=gatA PE=3 SV=1 173 356 9.0E-19
sp|C1D1L2|GATA_DEIDV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=gatA PE=3 SV=1 173 356 9.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FR37|AMI1_ARATH Amidase 1 OS=Arabidopsis thaliana GN=AMI1 PE=1 SV=1 203 604 7.0E-24
sp|B7PDC5|GATA_IXOSC Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ixodes scapularis GN=gatA PE=3 SV=1 202 356 5.0E-20
sp|C4ZHB9|GATA_EUBR3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=gatA PE=3 SV=1 203 357 1.0E-19
sp|Q1J0C2|GATA_DEIGD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus geothermalis (strain DSM 11300) GN=gatA PE=3 SV=1 173 356 9.0E-19
sp|C1D1L2|GATA_DEIDV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=gatA PE=3 SV=1 173 356 9.0E-19
sp|Q9RTA9|GATA_DEIRA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gatA PE=3 SV=1 171 356 1.0E-18
sp|A5GTM0|GATA_SYNR3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain RCC307) GN=gatA PE=3 SV=1 202 356 1.0E-18
sp|Q3Z6V3|GATA_DEHM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gatA PE=3 SV=1 201 357 2.0E-18
sp|Q6AQK1|GATA_DESPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=gatA PE=3 SV=1 202 356 8.0E-18
sp|Q7QH64|GATA_ANOGA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Anopheles gambiae GN=gatA PE=3 SV=3 203 356 1.0E-17
sp|B5ED19|GATA_GEOBB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gatA PE=3 SV=1 202 357 3.0E-17
sp|C6E6Z2|GATA_GEOSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter sp. (strain M21) GN=gatA PE=3 SV=1 202 357 3.0E-17
sp|Q3A2K0|GATA_PELCD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gatA PE=3 SV=1 200 357 5.0E-17
sp|Q3ZYM5|GATA_DEHMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain CBDB1) GN=gatA PE=3 SV=1 201 357 5.0E-17
sp|Q97EX8|GATA2_CLOAB Glutamyl-tRNA(Gln) amidotransferase subunit A 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatA2 PE=3 SV=1 203 356 6.0E-17
sp|A5FQ07|GATA_DEHMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=gatA PE=3 SV=1 201 357 6.0E-17
sp|A9KJ26|GATA_CLOPH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gatA PE=3 SV=1 173 356 8.0E-17
sp|Q8THJ1|GATA_METAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gatA PE=3 SV=1 202 357 1.0E-16
sp|B0WAE3|GATA_CULQU Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Culex quinquefasciatus GN=gatA PE=3 SV=1 202 356 1.0E-16
sp|Q12VH1|GATA_METBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gatA PE=3 SV=1 200 355 2.0E-16
sp|B4UIV1|GATA_ANASK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter sp. (strain K) GN=gatA PE=3 SV=1 203 357 2.0E-16
sp|Q1IUE4|GATA_KORVE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Koribacter versatilis (strain Ellin345) GN=gatA PE=3 SV=1 203 357 2.0E-16
sp|Q4J965|GATA_SULAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gatA PE=3 SV=1 203 357 3.0E-16
sp|E0VSP9|GATA_PEDHC Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Pediculus humanus subsp. corporis GN=gatA PE=3 SV=1 203 395 3.0E-16
sp|A0LSR0|GATA_ACIC1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=gatA PE=3 SV=1 173 356 4.0E-16
sp|Q2GEE7|GATA_NEOSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neorickettsia sennetsu (strain Miyayama) GN=gatA PE=3 SV=1 203 357 4.0E-16
sp|Q2IH94|GATA_ANADE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gatA PE=3 SV=1 203 357 4.0E-16
sp|B8JBQ1|GATA_ANAD2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=gatA PE=3 SV=1 203 357 8.0E-16
sp|Q73Q68|GATA_TREDE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gatA PE=3 SV=1 201 378 9.0E-16
sp|Q6A8P5|GATA_PROAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=gatA PE=3 SV=1 202 356 1.0E-15
sp|Q46E35|GATA_METBF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gatA PE=3 SV=1 202 357 1.0E-15
sp|Q5HBG3|GATA_EHRRW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia ruminantium (strain Welgevonden) GN=gatA PE=3 SV=1 193 356 1.0E-15
sp|A8M5E6|GATA_SALAI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinispora arenicola (strain CNS-205) GN=gatA PE=3 SV=1 141 356 2.0E-15
sp|E2QUD0|GATA_CANLF Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Canis lupus familiaris GN=QRSL1 PE=3 SV=1 203 356 3.0E-15
sp|Q5V2G6|GATA_HALMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gatA PE=3 SV=1 202 354 3.0E-15
sp|Q97ZG1|GATA_SULSO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gatA-2 PE=3 SV=1 203 357 3.0E-15
sp|F7A3P2|GATA_ORNAN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ornithorhynchus anatinus GN=QRSL1 PE=3 SV=1 203 356 3.0E-15
sp|F1QAJ4|GATA_DANRE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Danio rerio GN=qrsl1 PE=2 SV=1 192 356 3.0E-15
sp|Q8AVG9|GATA_XENLA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Xenopus laevis GN=qrsl1 PE=2 SV=1 200 356 4.0E-15
sp|Q60CK8|GATA_METCA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gatA PE=3 SV=1 197 356 4.0E-15
sp|Q8PXJ1|GATA_METMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gatA PE=3 SV=1 202 357 4.0E-15
sp|F4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana GN=OM64 PE=1 SV=1 199 368 5.0E-15
sp|Q2GGC5|GATA_EHRCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=gatA PE=3 SV=1 195 356 5.0E-15
sp|A6W7L7|GATA_KINRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=gatA PE=3 SV=1 202 356 5.0E-15
sp|B2IYD7|GATA_NOSP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gatA PE=3 SV=1 203 352 5.0E-15
sp|Q39ZK0|GATA_GEOMG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gatA PE=3 SV=1 202 380 5.0E-15
sp|B1WYP3|GATA_CYAA5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain ATCC 51142) GN=gatA PE=3 SV=1 203 357 6.0E-15
sp|Q9JTZ5|GATA_NEIMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gatA PE=3 SV=1 181 418 6.0E-15
sp|Q9HR43|GATA_HALSA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gatA PE=3 SV=1 199 420 7.0E-15
sp|Q0VFI5|GATA_XENTR Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Xenopus tropicalis GN=qrsl1 PE=2 SV=1 200 356 8.0E-15
sp|Q9H0R6|GATA_HUMAN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Homo sapiens GN=QRSL1 PE=1 SV=2 203 356 9.0E-15
sp|Q5PAL2|GATA_ANAMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaplasma marginale (strain St. Maries) GN=gatA PE=3 SV=1 202 356 9.0E-15
sp|B9KIR2|GATA_ANAMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaplasma marginale (strain Florida) GN=gatA PE=3 SV=1 202 356 9.0E-15
sp|Q5FHN7|GATA_EHRRG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia ruminantium (strain Gardel) GN=gatA PE=3 SV=2 203 356 9.0E-15
sp|Q3ISR6|GATA_NATPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gatA PE=3 SV=1 202 355 1.0E-14
sp|Q971U6|GATA_SULTO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gatA PE=3 SV=2 203 357 1.0E-14
sp|Q820J1|GATA_NITEU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gatA PE=3 SV=1 202 356 1.0E-14
sp|A5EY31|GATA_DICNV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dichelobacter nodosus (strain VCS1703A) GN=gatA PE=3 SV=1 199 410 1.0E-14
sp|B0JSX3|GATA_MICAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Microcystis aeruginosa (strain NIES-843) GN=gatA PE=3 SV=1 203 356 1.0E-14
sp|P75534|GATA_MYCPN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=gatA PE=3 SV=1 202 356 1.0E-14
sp|Q4R7R9|GATA_MACFA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Macaca fascicularis GN=QRSL1 PE=2 SV=1 203 356 1.0E-14
sp|B1YM01|GATA_EXIS2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=gatA PE=3 SV=1 197 356 1.0E-14
sp|Q5NPF3|GATA_ZYMMO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gatA PE=3 SV=1 201 356 2.0E-14
sp|B8I601|GATA_CLOCE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=gatA PE=3 SV=1 200 356 2.0E-14
sp|B7I7N2|GATA_ACIB5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AB0057) GN=gatA PE=3 SV=1 200 409 2.0E-14
sp|P73558|GATA_SYNY3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gatA PE=3 SV=1 203 356 2.0E-14
sp|C6BSE9|GATA_DESAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=gatA PE=3 SV=1 199 356 2.0E-14
sp|Q746Y7|GATA_GEOSL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gatA PE=3 SV=1 202 357 2.0E-14
sp|Q9CZN8|GATA_MOUSE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Mus musculus GN=Qrsl1 PE=1 SV=1 203 356 2.0E-14
sp|Q9Z9G7|GATA_CHLPN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia pneumoniae GN=gatA PE=3 SV=1 203 355 2.0E-14
sp|C4Z3J4|GATA_EUBE2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=gatA PE=3 SV=1 202 357 2.0E-14
sp|Q17H91|GATA_AEDAE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Aedes aegypti GN=gatA PE=3 SV=1 200 356 2.0E-14
sp|B7K0I2|GATA_CYAP8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 8801) GN=gatA PE=3 SV=1 197 369 2.0E-14
sp|A1KUH8|GATA_NEIMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gatA PE=3 SV=1 181 418 3.0E-14
sp|B1GZD3|GATA_UNCTG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gatA PE=3 SV=1 197 429 3.0E-14
sp|A0Q2Q0|GATA_CLONN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium novyi (strain NT) GN=gatA PE=3 SV=1 201 357 3.0E-14
sp|Q0SNH0|GATA_BORAP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Borrelia afzelii (strain PKo) GN=gatA PE=3 SV=1 202 356 3.0E-14
sp|A8AVE2|GATA_STRGC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gatA PE=3 SV=1 203 352 3.0E-14
sp|Q88XP7|GATA_LACPL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gatA PE=3 SV=1 199 356 3.0E-14
sp|Q661S5|GATA_BORBP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=gatA PE=3 SV=1 202 356 3.0E-14
sp|A5UXF9|GATA_ROSS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseiflexus sp. (strain RS-1) GN=gatA PE=3 SV=1 202 356 4.0E-14
sp|Q6MRL7|GATA_BDEBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gatA PE=3 SV=1 203 352 4.0E-14
sp|Q2RGY4|GATA_MOOTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Moorella thermoacetica (strain ATCC 39073) GN=gatA PE=3 SV=1 202 357 4.0E-14
sp|B4RM85|GATA_NEIG2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gatA PE=3 SV=1 181 426 5.0E-14
sp|B0VEN3|GATA_ACIBY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AYE) GN=gatA PE=3 SV=1 200 409 5.0E-14
sp|B2HY00|GATA_ACIBC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain ACICU) GN=gatA PE=3 SV=1 200 409 5.0E-14
sp|B7GXC5|GATA_ACIB3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AB307-0294) GN=gatA PE=3 SV=1 200 409 5.0E-14
sp|A4X490|GATA_SALTO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=gatA PE=3 SV=1 202 356 5.0E-14
sp|B0VS13|GATA_ACIBS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain SDF) GN=gatA PE=3 SV=1 200 409 5.0E-14
sp|Q2FQM9|GATA_METHJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=gatA PE=3 SV=1 202 357 6.0E-14
sp|A4J6Z8|GATA_DESRM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfotomaculum reducens (strain MI-1) GN=gatA PE=3 SV=1 202 357 6.0E-14
sp|Q6FDY3|GATA_ACIAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gatA PE=3 SV=1 203 409 6.0E-14
sp|A9M003|GATA_NEIM0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup C (strain 053442) GN=gatA PE=3 SV=1 181 418 6.0E-14
sp|A3M8F1|GATA_ACIBT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=gatA PE=3 SV=2 200 408 7.0E-14
sp|B8G974|GATA_CHLAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=gatA PE=3 SV=1 199 368 7.0E-14
sp|A5G9J9|GATA_GEOUR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter uraniireducens (strain Rf4) GN=gatA PE=3 SV=1 203 357 7.0E-14
sp|O51317|GATA_BORBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gatA PE=3 SV=2 202 356 7.0E-14
sp|A7NKM0|GATA_ROSCS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=gatA PE=3 SV=1 202 356 7.0E-14
sp|B7KLL5|GATA_CYAP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 7424) GN=gatA PE=3 SV=1 197 356 8.0E-14
sp|B1I3K2|GATA_DESAP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulforudis audaxviator (strain MP104C) GN=gatA PE=3 SV=1 202 383 8.0E-14
sp|Q9JYZ9|GATA_NEIMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup B (strain MC58) GN=gatA PE=3 SV=1 181 418 8.0E-14
sp|Q9Z580|GATA_STRCO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gatA PE=3 SV=1 202 356 9.0E-14
sp|Q8YY02|GATA_NOSS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gatA PE=3 SV=1 203 396 9.0E-14
sp|Q29RP9|GATA_BOVIN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Bos taurus GN=QRSL1 PE=2 SV=1 203 356 9.0E-14
sp|Q03EG5|GATA_PEDPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=gatA PE=3 SV=1 204 356 1.0E-13
sp|Q31LC2|GATA_SYNE7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus elongatus (strain PCC 7942) GN=gatA PE=3 SV=1 203 356 1.0E-13
sp|Q2J6U6|GATA_FRASC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Frankia sp. (strain CcI3) GN=gatA PE=3 SV=1 202 356 1.0E-13
sp|Q936X3|ATZE_PSESD Biuret hydrolase OS=Pseudomonas sp. (strain ADP) GN=atzE PE=1 SV=1 202 355 1.0E-13
sp|Q9LVH5|OE64C_ARATH Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana GN=OEP64 PE=1 SV=1 205 368 1.0E-13
sp|Q5F8U8|GATA_NEIG1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gatA PE=3 SV=1 181 418 1.0E-13
sp|Q0VS72|GATA_ALCBS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gatA PE=3 SV=1 203 391 1.0E-13
sp|A8ZSP8|GATA_DESOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=gatA PE=3 SV=1 202 357 1.0E-13
sp|Q5N0K5|GATA_SYNP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gatA PE=3 SV=1 203 356 1.0E-13
sp|B0C269|GATA_ACAM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acaryochloris marina (strain MBIC 11017) GN=gatA PE=3 SV=1 203 356 1.0E-13
sp|P95896|AMID_SULSO Amidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2122 PE=1 SV=1 203 355 2.0E-13
sp|B9LER8|GATA_CHLSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=gatA PE=3 SV=1 202 362 2.0E-13
sp|A9WCD8|GATA_CHLAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=gatA PE=3 SV=1 202 362 2.0E-13
sp|Q0I9N6|GATA_SYNS3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9311) GN=gatA PE=3 SV=1 202 372 2.0E-13
sp|Q3M6N4|GATA_ANAVT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gatA PE=3 SV=1 203 352 2.0E-13
sp|A5ICP2|GATA_LEGPC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Corby) GN=gatA PE=3 SV=1 181 403 2.0E-13
sp|Q2YC91|GATA_NITMU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gatA PE=3 SV=2 184 356 2.0E-13
sp|Q5X4H5|GATA_LEGPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Paris) GN=gatA PE=3 SV=1 181 403 2.0E-13
sp|B9LZ18|GATA_GEODF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=gatA PE=3 SV=1 203 357 2.0E-13
sp|A3CLF8|GATA_STRSV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus sanguinis (strain SK36) GN=gatA PE=3 SV=1 203 352 2.0E-13
sp|B8HY89|GATA_CYAP4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=gatA PE=3 SV=1 196 357 2.0E-13
sp|C4L690|GATA_EXISA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=gatA PE=3 SV=1 197 356 2.0E-13
sp|C5Y8Z8|GATA_SORBI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Sorghum bicolor GN=GATA PE=3 SV=1 197 355 2.0E-13
sp|B8J405|GATA_DESDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=gatA PE=3 SV=1 199 356 3.0E-13
sp|Q5LP80|GATA_RUEPO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gatA PE=3 SV=1 160 357 3.0E-13
sp|Q5FWT5|GATA_RAT Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Rattus norvegicus GN=Qrsl1 PE=2 SV=1 203 356 3.0E-13
sp|C3PMJ0|GATA_RICAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia africae (strain ESF-5) GN=gatA PE=3 SV=1 195 392 3.0E-13
sp|C1F857|GATA_ACIC5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=gatA PE=3 SV=1 199 355 3.0E-13
sp|C4K0R4|GATA_RICPU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia peacockii (strain Rustic) GN=gatA PE=3 SV=1 195 392 3.0E-13
sp|Q5L6I9|GATA_CHLAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=gatA PE=3 SV=1 203 354 3.0E-13
sp|Q82JL0|GATA_STRAW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gatA PE=3 SV=1 202 356 3.0E-13
sp|A8GQX7|GATA_RICRS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia rickettsii (strain Sheila Smith) GN=gatA PE=3 SV=1 195 392 3.0E-13
sp|B0BWC3|GATA_RICRO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia rickettsii (strain Iowa) GN=gatA PE=3 SV=1 195 392 3.0E-13
sp|Q92J75|GATA_RICCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gatA PE=3 SV=1 195 392 3.0E-13
sp|Q29BT3|GATA_DROPS Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=gatA PE=3 SV=2 194 356 3.0E-13
sp|Q5ZUQ7|GATA_LEGPH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gatA PE=3 SV=1 181 403 3.0E-13
sp|B3CMT8|GATA_WOLPP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=gatA PE=3 SV=1 202 356 3.0E-13
sp|Q54L63|GATA_DICDI Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Dictyostelium discoideum GN=gatA PE=3 SV=1 195 357 3.0E-13
sp|Q5XAC7|GATA_STRP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gatA PE=3 SV=1 203 352 3.0E-13
sp|Q7V7T6|GATA_PROMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9313) GN=gatA PE=3 SV=1 202 352 4.0E-13
sp|Q9ZE10|GATA_RICPR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia prowazekii (strain Madrid E) GN=gatA PE=3 SV=1 195 392 4.0E-13
sp|P0CZ61|GATA_STRPQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gatA PE=3 SV=1 203 352 4.0E-13
sp|P0CZ60|GATA_STRP3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gatA PE=3 SV=1 203 352 4.0E-13
sp|B2A5W7|GATA_NATTJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=gatA PE=3 SV=1 202 357 4.0E-13
sp|Q8NZM0|GATA_STRP8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gatA PE=3 SV=1 203 352 4.0E-13
sp|A2CA16|GATA_PROM3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9303) GN=gatA PE=3 SV=1 202 352 4.0E-13
sp|Q1JKC7|GATA_STRPC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gatA PE=3 SV=1 203 352 4.0E-13
sp|Q1JA74|GATA_STRPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=gatA PE=3 SV=1 203 352 4.0E-13
sp|Q48RQ4|GATA_STRPM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gatA PE=3 SV=1 203 352 4.0E-13
sp|A0LP22|GATA_SYNFM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=gatA PE=3 SV=1 200 357 4.0E-13
sp|Q1J569|GATA_STRPF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gatA PE=3 SV=1 203 352 4.0E-13
sp|Q5WVW0|GATA_LEGPL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Lens) GN=gatA PE=3 SV=1 181 403 4.0E-13
sp|Q9VE09|GATA_DROME Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Drosophila melanogaster GN=gatA PE=2 SV=1 194 356 5.0E-13
sp|Q3YSB0|GATA_EHRCJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia canis (strain Jake) GN=gatA PE=3 SV=2 202 356 5.0E-13
sp|A9B9W7|GATA_PROM4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9211) GN=gatA PE=3 SV=1 202 352 5.0E-13
sp|Q68XL6|GATA_RICTY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gatA PE=3 SV=1 195 392 5.0E-13
sp|A5GKM7|GATA_SYNPW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain WH7803) GN=gatA PE=3 SV=1 202 391 6.0E-13
sp|Q73HP2|GATA_WOLPM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia pipientis wMel GN=gatA PE=3 SV=1 202 356 6.0E-13
sp|A1U486|GATA_MARHV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gatA PE=3 SV=1 166 356 6.0E-13
sp|Q0AFP4|GATA_NITEC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosomonas eutropha (strain C91) GN=gatA PE=3 SV=1 203 356 6.0E-13
sp|C0R5M6|GATA_WOLWR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=gatA PE=3 SV=1 202 356 6.0E-13
sp|Q113L8|GATA_TRIEI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Trichodesmium erythraeum (strain IMS101) GN=gatA PE=3 SV=1 203 356 6.0E-13
sp|B8D125|GATA_HALOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gatA PE=3 SV=1 203 357 7.0E-13
sp|B4U197|GATA_STREM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=gatA PE=3 SV=1 203 352 8.0E-13
sp|Q9YB80|GATA_AERPE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gatA PE=3 SV=2 203 356 9.0E-13
sp|O27955|GATA_ARCFU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gatA PE=3 SV=1 203 355 9.0E-13
sp|Q2G4F5|GATA_NOVAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gatA PE=3 SV=1 197 407 9.0E-13
sp|Q7X8Z8|GATA_ORYSJ Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=GATA PE=3 SV=3 199 359 9.0E-13
sp|Q0ACB5|GATA_ALKEH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gatA PE=3 SV=1 200 356 1.0E-12
sp|B6U151|GATA_MAIZE Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Zea mays GN=GATA PE=2 SV=1 197 355 1.0E-12
sp|Q25A68|GATA_ORYSI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Oryza sativa subsp. indica GN=GATA PE=3 SV=1 199 359 1.0E-12
sp|C0ME97|GATA_STRS7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=gatA PE=3 SV=1 203 352 1.0E-12
sp|C0M7E8|GATA_STRE4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. equi (strain 4047) GN=gatA PE=3 SV=1 203 352 1.0E-12
sp|B1XJG8|GATA_SYNP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gatA PE=3 SV=1 203 356 1.0E-12
sp|Q253Q1|GATA_CHLFF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydophila felis (strain Fe/C-56) GN=gatA PE=3 SV=1 203 352 1.0E-12
sp|Q3AD36|GATA_CARHZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gatA PE=3 SV=1 202 356 1.0E-12
sp|P27765|AMID_PSECL Amidase OS=Pseudomonas chlororaphis PE=1 SV=3 203 352 1.0E-12
sp|Q67KJ2|GATA_SYMTH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gatA PE=3 SV=1 198 357 1.0E-12
sp|Q83BM9|GATA_COXBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gatA PE=3 SV=1 186 356 1.0E-12
sp|A9N8Z4|GATA_COXBR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gatA PE=3 SV=1 186 356 1.0E-12
sp|A9KBI0|GATA_COXBN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gatA PE=3 SV=1 186 356 1.0E-12
sp|B6IZ25|GATA_COXB2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain CbuG_Q212) GN=gatA PE=3 SV=1 186 356 1.0E-12
sp|B6J4H5|GATA_COXB1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain CbuK_Q154) GN=gatA PE=3 SV=1 186 356 1.0E-12
sp|B0TDK7|GATA_HELMI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=gatA PE=3 SV=1 199 391 1.0E-12
sp|Q3AVK4|GATA_SYNS9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9902) GN=gatA PE=3 SV=1 202 352 1.0E-12
sp|A8GV46|GATA_RICB8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia bellii (strain OSU 85-389) GN=gatA PE=3 SV=1 195 356 1.0E-12
sp|A8EXM1|GATA_RICCK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia canadensis (strain McKiel) GN=gatA PE=3 SV=1 195 392 1.0E-12
sp|A1WVR7|GATA_HALHL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gatA PE=3 SV=1 200 356 1.0E-12
sp|A8GMC0|GATA_RICAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia akari (strain Hartford) GN=gatA PE=3 SV=1 195 392 1.0E-12
sp|Q0AZZ2|GATA_SYNWW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gatA PE=3 SV=1 203 357 2.0E-12
sp|A5CX65|GATA_VESOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=gatA PE=3 SV=1 200 356 2.0E-12
sp|Q3J7V7|GATA_NITOC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gatA PE=3 SV=1 203 356 2.0E-12
sp|Q1RHE9|GATA_RICBR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia bellii (strain RML369-C) GN=gatA PE=3 SV=1 195 356 2.0E-12
sp|A2RCV7|GATA_STRPG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gatA PE=3 SV=1 203 352 2.0E-12
sp|Q5GRM3|GATA_WOLTR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=gatA PE=3 SV=2 202 356 2.0E-12
sp|Q4UKF1|GATA_RICFE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gatA PE=3 SV=1 195 392 2.0E-12
sp|O84006|GATA_CHLTR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gatA PE=3 SV=1 203 352 2.0E-12
sp|B0BAY9|GATA_CHLTB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gatA PE=3 SV=1 203 352 2.0E-12
sp|Q3KN19|GATA_CHLTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gatA PE=3 SV=1 203 352 2.0E-12
sp|B0B9B0|GATA_CHLT2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gatA PE=3 SV=1 203 352 2.0E-12
sp|Q1JFB9|GATA_STRPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gatA PE=3 SV=1 203 352 2.0E-12
sp|B8FCK9|GATA_DESAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfatibacillum alkenivorans (strain AK-01) GN=gatA PE=3 SV=1 202 356 2.0E-12
sp|Q04BV7|GATA_LACDB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=gatA PE=3 SV=1 203 356 2.0E-12
sp|Q1GBF4|GATA_LACDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=gatA PE=3 SV=1 203 356 2.0E-12
sp|Q1DCA3|GATA_MYXXD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Myxococcus xanthus (strain DK 1622) GN=gatA PE=3 SV=1 200 356 2.0E-12
sp|C5BSY8|GATA_TERTT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gatA PE=3 SV=1 200 413 2.0E-12
sp|Q313S5|GATA_DESAG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio alaskensis (strain G20) GN=gatA PE=3 SV=1 200 356 2.0E-12
sp|E0CTY1|GATA_VITVI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Vitis vinifera GN=GATA PE=3 SV=1 202 355 2.0E-12
sp|Q5AQN0|GATA_EMENI Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN9400 PE=3 SV=2 203 356 3.0E-12
sp|B5XHZ9|GATA_STRPZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gatA PE=3 SV=1 203 352 3.0E-12
sp|Q8DK65|GATA_THEEB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermosynechococcus elongatus (strain BP-1) GN=gatA PE=3 SV=2 203 355 3.0E-12
sp|O69768|AMID_PSEPU Amidase OS=Pseudomonas putida PE=3 SV=1 202 356 3.0E-12
sp|Q2LXM9|GATA_SYNAS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophus aciditrophicus (strain SB) GN=gatA PE=3 SV=1 203 357 4.0E-12
sp|B2V855|GATA_SULSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=gatA PE=3 SV=1 203 356 4.0E-12
sp|B9DVG6|GATA_STRU0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=gatA PE=3 SV=1 203 352 5.0E-12
sp|Q8RC40|GATA_CALS4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gatA PE=3 SV=1 200 357 5.0E-12
sp|Q2JUM6|GATA_SYNJA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain JA-3-3Ab) GN=gatA PE=3 SV=1 202 356 5.0E-12
sp|Q5FLL1|GATA_LACAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gatA PE=3 SV=1 193 356 5.0E-12
sp|Q99YC0|GATA_STRP1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M1 GN=gatA PE=3 SV=1 203 352 5.0E-12
sp|Q2JL51|GATA_SYNJB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gatA PE=3 SV=1 199 356 6.0E-12
sp|O66610|GATA_AQUAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aquifex aeolicus (strain VF5) GN=gatA PE=1 SV=1 202 356 6.0E-12
sp|A8F5H6|GATA_PSELT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gatA PE=3 SV=1 202 356 6.0E-12
sp|Q9LI77|GATA_ARATH Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GATA PE=2 SV=1 202 355 7.0E-12
sp|B8GL95|GATA_THISH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=gatA PE=3 SV=1 166 355 7.0E-12
sp|Q3AKH0|GATA_SYNSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9605) GN=gatA PE=3 SV=1 199 352 7.0E-12
sp|A8YTZ6|GATA_LACH4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus helveticus (strain DPC 4571) GN=gatA PE=3 SV=1 203 356 8.0E-12
sp|Q9MUK5|TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum GN=TOC64 PE=1 SV=1 204 368 8.0E-12
sp|Q7U7F4|GATA_SYNPX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain WH8102) GN=gatA PE=3 SV=1 202 352 8.0E-12
sp|Q58560|GATA_METJA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=gatA PE=3 SV=1 197 362 8.0E-12
sp|A1ATL3|GATA_PELPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelobacter propionicus (strain DSM 2379) GN=gatA PE=3 SV=1 200 357 8.0E-12
sp|A1K1T5|GATA_AZOSB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azoarcus sp. (strain BH72) GN=gatA PE=3 SV=1 200 352 8.0E-12
sp|C3KU97|GATA_CLOB6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain 657 / Type Ba4) GN=gatA PE=3 SV=1 201 357 9.0E-12
sp|C1FLD9|GATA_CLOBJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Kyoto / Type A2) GN=gatA PE=3 SV=1 201 357 9.0E-12
sp|B1INF7|GATA_CLOBK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Okra / Type B1) GN=gatA PE=3 SV=1 201 408 9.0E-12
sp|Q1MPY8|GATA_LAWIP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gatA PE=3 SV=1 201 356 1.0E-11
sp|Q84DC4|MANHY_PSEPU Mandelamide hydrolase OS=Pseudomonas putida GN=mdlY PE=1 SV=1 202 356 1.0E-11
sp|A5WCI2|GATA_PSYWF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter sp. (strain PRwf-1) GN=gatA PE=3 SV=1 203 356 1.0E-11
sp|Q2GJX4|GATA_ANAPZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaplasma phagocytophilum (strain HZ) GN=gatA PE=3 SV=1 202 356 1.0E-11
sp|A6VH97|GATA_METM7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=gatA PE=3 SV=1 201 376 1.0E-11
sp|Q1GUW3|GATA_SPHAL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gatA PE=3 SV=1 201 356 1.0E-11
sp|Q3SM39|GATA_THIDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gatA PE=3 SV=1 202 355 1.0E-11
sp|Q97FQ7|GATA1_CLOAB Glutamyl-tRNA(Gln) amidotransferase subunit A 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatA1 PE=3 SV=1 203 357 1.0E-11
sp|Q9PL37|GATA_CHLMU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gatA PE=3 SV=1 203 352 1.0E-11
sp|A5I6Z3|GATA_CLOBH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gatA PE=3 SV=1 201 408 1.0E-11
sp|A7FYL3|GATA_CLOB1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gatA PE=3 SV=1 201 408 1.0E-11
sp|B0T193|GATA_CAUSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter sp. (strain K31) GN=gatA PE=3 SV=1 183 356 1.0E-11
sp|Q8UFS8|GATA_AGRFC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gatA PE=3 SV=2 161 357 2.0E-11
sp|A5V3V0|GATA_SPHWW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gatA PE=3 SV=1 202 426 2.0E-11
sp|Q2RPH4|GATA_RHORT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gatA PE=3 SV=1 200 356 2.0E-11
sp|Q8G768|GATA_BIFLO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum (strain NCC 2705) GN=gatA PE=3 SV=1 197 356 2.0E-11
sp|B3DU32|GATA_BIFLD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum (strain DJO10A) GN=gatA PE=3 SV=1 197 356 2.0E-11
sp|Q07L94|GATA_RHOP5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain BisA53) GN=gatA PE=3 SV=1 175 356 2.0E-11
sp|Q47SC3|GATA_THEFY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermobifida fusca (strain YX) GN=gatA PE=3 SV=1 202 357 2.0E-11
sp|B7GTU6|GATA_BIFLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=gatA PE=3 SV=1 197 356 2.0E-11
sp|Q4FLQ7|GATA_PELUB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelagibacter ubique (strain HTCC1062) GN=gatA PE=3 SV=1 203 426 2.0E-11
sp|O06491|GATA_BACSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus subtilis (strain 168) GN=gatA PE=3 SV=3 203 356 2.0E-11
sp|Q168I9|GATA_ROSDO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gatA PE=3 SV=1 199 356 2.0E-11
sp|B1L1G9|GATA_CLOBM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gatA PE=3 SV=1 201 357 2.0E-11
sp|A7GIK2|GATA_CLOBL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gatA PE=3 SV=1 201 357 2.0E-11
sp|A2C1Y1|GATA_PROM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain NATL1A) GN=gatA PE=3 SV=1 202 357 2.0E-11
sp|Q46L72|GATA_PROMT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain NATL2A) GN=gatA PE=3 SV=1 202 357 3.0E-11
sp|Q5FND3|GATA_GLUOX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Gluconobacter oxydans (strain 621H) GN=gatA PE=3 SV=1 140 357 3.0E-11
sp|A9WYR3|GATA_BRUSI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gatA PE=3 SV=1 161 383 3.0E-11
sp|Q6C0M4|GATA_YARLI Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HER2 PE=3 SV=1 203 357 3.0E-11
sp|A9A9F2|GATA_METM6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=gatA PE=3 SV=1 201 368 3.0E-11
sp|Q28T24|GATA_JANSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Jannaschia sp. (strain CCS1) GN=gatA PE=3 SV=1 155 356 3.0E-11
sp|A8N8S3|GATA_COPC7 Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_00798 PE=3 SV=1 202 357 3.0E-11
sp|Q2S4S2|GATA_SALRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gatA PE=3 SV=1 201 356 3.0E-11
sp|Q31F53|GATA_THICR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thiomicrospira crunogena (strain XCL-2) GN=gatA PE=3 SV=1 203 356 3.0E-11
sp|Q8YC57|GATA_BRUME Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gatA PE=3 SV=2 161 357 3.0E-11
sp|Q21FS8|GATA_SACD2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gatA PE=3 SV=1 200 356 4.0E-11
sp|Q74I52|GATA_LACJO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gatA PE=3 SV=1 203 356 4.0E-11
sp|Q03AC0|GATA_LACC3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus casei (strain ATCC 334) GN=gatA PE=3 SV=1 201 356 4.0E-11
sp|C0RLB5|GATA_BRUMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gatA PE=3 SV=1 161 357 4.0E-11
sp|Q1QDJ4|GATA_PSYCK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter cryohalolentis (strain K5) GN=gatA PE=3 SV=1 201 356 4.0E-11
sp|A6X562|GATA_OCHA4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gatA PE=3 SV=1 161 357 4.0E-11
sp|B3CQQ9|GATA_ORITI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Orientia tsutsugamushi (strain Ikeda) GN=gatA PE=3 SV=1 184 356 4.0E-11
sp|A0L5G0|GATA_MAGMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gatA PE=3 SV=1 202 356 4.0E-11
sp|A5VUS6|GATA_BRUO2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gatA PE=3 SV=1 161 357 4.0E-11
sp|B7GFW3|GATA_ANOFW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=gatA PE=3 SV=1 203 356 4.0E-11
sp|A9MBN4|GATA_BRUC2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gatA PE=3 SV=1 161 357 4.0E-11
sp|B3EA24|GATA_GEOLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gatA PE=3 SV=1 202 391 4.0E-11
sp|Q72L58|GATA_THET2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gatA PE=3 SV=1 202 356 4.0E-11
sp|C5D4K6|GATA_GEOSW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus sp. (strain WCH70) GN=gatA PE=3 SV=1 203 405 5.0E-11
sp|Q9LCX3|GATA_THET8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gatA PE=1 SV=2 202 356 5.0E-11
sp|B7KWB0|GATA_METC4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=gatA PE=3 SV=1 183 356 5.0E-11
sp|Q8FW67|GATA_BRUSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella suis biovar 1 (strain 1330) GN=gatA PE=3 SV=1 161 357 5.0E-11
sp|A1AW13|GATA_RUTMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gatA PE=3 SV=1 200 356 5.0E-11
sp|Q83GA1|GATA_TROWT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Tropheryma whipplei (strain Twist) GN=gatA PE=3 SV=1 198 352 5.0E-11
sp|A4IJZ2|GATA_GEOTN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gatA PE=3 SV=1 202 356 5.0E-11
sp|Q7UT33|GATA_RHOBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gatA PE=3 SV=1 202 370 5.0E-11
sp|Q83HX2|GATA_TROW8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Tropheryma whipplei (strain TW08/27) GN=gatA PE=3 SV=2 198 352 5.0E-11
sp|Q48E92|GATA_PSE14 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gatA PE=3 SV=1 202 356 5.0E-11
sp|Q93LE2|GATA_GEOSE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus stearothermophilus GN=gatA PE=3 SV=1 202 356 5.0E-11
sp|B3WD57|GATA_LACCB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus casei (strain BL23) GN=gatA PE=3 SV=1 201 356 5.0E-11
sp|O28325|Y1954_ARCFU Putative amidase AF_1954 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1954 PE=3 SV=1 202 356 6.0E-11
sp|B0K3S3|GATA_THEPX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermoanaerobacter sp. (strain X514) GN=gatA PE=3 SV=1 203 357 6.0E-11
sp|Q11IL4|GATA_CHESB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chelativorans sp. (strain BNC1) GN=gatA PE=3 SV=1 187 357 6.0E-11
sp|Q5L3B3|GATA_GEOKA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus kaustophilus (strain HTA426) GN=gatA PE=3 SV=1 202 356 7.0E-11
sp|B0KBN4|GATA_THEP3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gatA PE=3 SV=1 203 357 7.0E-11
sp|Q4FUG4|GATA_PSYA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gatA PE=3 SV=1 201 356 7.0E-11
sp|Q146Y5|GATA_BURXL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia xenovorans (strain LB400) GN=gatA PE=3 SV=1 200 356 8.0E-11
sp|Q7VCJ0|GATA_PROMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gatA PE=3 SV=1 202 352 8.0E-11
sp|A8I9X6|GATA_AZOC5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gatA PE=3 SV=1 183 356 8.0E-11
sp|A8LJ23|GATA_DINSH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gatA PE=3 SV=1 200 357 8.0E-11
sp|P9WQ93|AMI4_MYCTU Putative amidase AmiD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=amiD PE=1 SV=1 203 356 9.0E-11
sp|P9WQ92|AMI4_MYCTO Putative amidase AmiD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=amiD PE=3 SV=1 203 356 9.0E-11
sp|P63497|AMI4_MYCBO Putative amidase AmiD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=amiD PE=3 SV=1 203 356 9.0E-11
sp|Q2K939|GATA_RHIEC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gatA PE=3 SV=1 148 357 9.0E-11
sp|Q8DSG5|GATA_STRMU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gatA PE=3 SV=1 203 352 9.0E-11
sp|P84650|AMID_RHORH Enantioselective amidase OS=Rhodococcus rhodochrous GN=amdA PE=1 SV=1 198 356 9.0E-11
sp|Q6LX43|GATA_METMP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain S2 / LL) GN=gatA PE=3 SV=1 201 376 9.0E-11
sp|Q2SBG5|GATA_HAHCH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Hahella chejuensis (strain KCTC 2396) GN=gatA PE=3 SV=1 203 356 9.0E-11
sp|Q75D84|GATA_ASHGO Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HER2 PE=3 SV=2 201 368 1.0E-10
sp|Q0BZV5|GATA_HYPNA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Hyphomonas neptunium (strain ATCC 15444) GN=gatA PE=3 SV=1 183 356 1.0E-10
sp|A5CEC8|GATA_ORITB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Orientia tsutsugamushi (strain Boryong) GN=gatA PE=3 SV=1 184 356 1.0E-10
sp|A4FW11|GATA_METM5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=gatA PE=3 SV=1 201 376 1.0E-10
sp|Q1GFB5|GATA_RUEST Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruegeria sp. (strain TM1040) GN=gatA PE=3 SV=1 200 357 1.0E-10
sp|A4XQK6|GATA_PSEMY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas mendocina (strain ymp) GN=gatA PE=3 SV=1 203 412 1.0E-10
sp|B5YL59|GATA_THEYD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gatA PE=3 SV=1 203 356 1.0E-10
sp|A6VWN0|GATA_MARMS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Marinomonas sp. (strain MWYL1) GN=gatA PE=3 SV=1 203 411 1.0E-10
sp|B1ZLM1|GATA_METPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gatA PE=3 SV=1 183 356 1.0E-10
sp|Q87WR9|GATA_PSESM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gatA PE=3 SV=1 202 356 1.0E-10
sp|Q7NKF0|GATA_GLOVI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Gloeobacter violaceus (strain PCC 7421) GN=gatA PE=3 SV=1 203 356 1.0E-10
sp|C0QKZ5|GATA_DESAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=gatA PE=3 SV=1 202 356 2.0E-10
sp|A6TTJ8|GATA_ALKMQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alkaliphilus metalliredigens (strain QYMF) GN=gatA PE=3 SV=1 203 352 2.0E-10
sp|A7Z267|GATA_BACMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gatA PE=3 SV=1 203 356 2.0E-10
sp|B1HTW9|GATA_LYSSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lysinibacillus sphaericus (strain C3-41) GN=gatA PE=3 SV=1 166 357 2.0E-10
sp|B0TWN0|GATA_FRAP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gatA PE=3 SV=1 203 534 2.0E-10
sp|A9I0H5|GATA_BORPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gatA PE=3 SV=1 202 355 2.0E-10
sp|Q041K5|GATA_LACGA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=gatA PE=3 SV=1 199 356 2.0E-10
sp|Q2IXB7|GATA_RHOP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain HaA2) GN=gatA PE=3 SV=1 175 356 2.0E-10
sp|B2T1M4|GATA_BURPP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gatA PE=3 SV=1 200 356 2.0E-10
sp|Q1GYD3|GATA_METFK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gatA PE=3 SV=1 200 356 2.0E-10
sp|B9DMT8|GATA_STACT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus carnosus (strain TM300) GN=gatA PE=3 SV=1 203 357 3.0E-10
sp|Q577Z3|GATA_BRUAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus biovar 1 (strain 9-941) GN=gatA PE=3 SV=1 161 357 3.0E-10
sp|Q2YKL3|GATA_BRUA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus (strain 2308) GN=gatA PE=3 SV=1 161 357 3.0E-10
sp|B2SB62|GATA_BRUA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus (strain S19) GN=gatA PE=3 SV=1 161 357 3.0E-10
sp|B2S4Q7|GATA_TREPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gatA PE=3 SV=1 199 355 3.0E-10
sp|O83983|GATA_TREPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Treponema pallidum (strain Nichols) GN=gatA PE=3 SV=1 199 355 3.0E-10
sp|Q6NHQ1|GATA_CORDI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=gatA PE=3 SV=1 166 356 3.0E-10
sp|A9W748|GATA_METEP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium extorquens (strain PA1) GN=gatA PE=3 SV=1 183 356 3.0E-10
sp|Q98M95|GATA_RHILO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium loti (strain MAFF303099) GN=gatA PE=3 SV=1 161 426 3.0E-10
sp|Q8Y3C3|GATA_RALSO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ralstonia solanacearum (strain GMI1000) GN=gatA PE=3 SV=1 200 356 4.0E-10
sp|A7GKK3|GATA_BACCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gatA PE=3 SV=1 203 356 4.0E-10
sp|Q1MHJ5|GATA_RHIL3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gatA PE=3 SV=1 148 357 4.0E-10
sp|Q6AEE8|GATA_LEIXX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=gatA PE=3 SV=1 202 356 4.0E-10
sp|C3MAA3|GATA_RHISN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium sp. (strain NGR234) GN=gatA PE=3 SV=1 181 357 4.0E-10
sp|A4VT83|GATA_STRSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus suis (strain 05ZYH33) GN=gatA PE=3 SV=1 203 352 5.0E-10
sp|A4VZG5|GATA_STRS2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus suis (strain 98HAH33) GN=gatA PE=3 SV=1 203 352 5.0E-10
sp|Q5NIP6|GATA_FRATT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gatA PE=3 SV=1 203 386 5.0E-10
sp|Q14K49|GATA_FRAT1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gatA PE=3 SV=1 203 386 5.0E-10
sp|B2SEM6|GATA_FRATM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gatA PE=3 SV=1 203 386 5.0E-10
sp|Q4ZNS7|GATA_PSEU2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gatA PE=3 SV=1 202 356 6.0E-10
sp|Q135J7|GATA_RHOPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain BisB5) GN=gatA PE=3 SV=1 164 356 6.0E-10
sp|B8EPC1|GATA_METSB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gatA PE=3 SV=1 183 356 6.0E-10
sp|Q3SR31|GATA_NITWN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gatA PE=3 SV=1 197 356 6.0E-10
sp|A0Q8I2|GATA_FRATN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. novicida (strain U112) GN=gatA PE=3 SV=1 203 386 7.0E-10
sp|Q49091|GATA_MORCA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Moraxella catarrhalis GN=gatA PE=3 SV=1 201 356 7.0E-10
sp|B3PC08|GATA_CELJU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cellvibrio japonicus (strain Ueda107) GN=gatA PE=3 SV=1 203 356 7.0E-10
sp|Q7WEV1|GATA_BORBR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gatA PE=3 SV=1 202 355 8.0E-10
sp|B5ZMJ0|GATA_RHILW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gatA PE=3 SV=1 148 357 8.0E-10
sp|Q7W3H7|GATA_BORPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gatA PE=3 SV=1 202 355 8.0E-10
sp|Q1QL30|GATA_NITHX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gatA PE=3 SV=1 183 356 9.0E-10
sp|Q8Y6D2|GATA_LISMO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gatA PE=3 SV=1 203 357 9.0E-10
sp|Q92AQ3|GATA_LISIN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gatA PE=3 SV=1 203 357 9.0E-10
sp|Q0BK40|GATA_FRATO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gatA PE=3 SV=1 203 386 9.0E-10
sp|Q2A1D8|GATA_FRATH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gatA PE=3 SV=1 203 386 9.0E-10
sp|A7NEM1|GATA_FRATF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gatA PE=3 SV=1 203 386 9.0E-10
sp|A0AJK8|GATA_LISW6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gatA PE=3 SV=1 203 357 9.0E-10
sp|P47345|GATA_MYCGE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=gatA PE=3 SV=1 210 356 9.0E-10
sp|B3QYQ7|GATA_CHLT3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gatA PE=3 SV=1 203 356 9.0E-10
sp|Q7VSN2|GATA_BORPE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gatA PE=3 SV=1 202 355 1.0E-09
sp|Q9A5L0|GATA_CAUCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gatA PE=3 SV=1 200 356 1.0E-09
sp|B8GZJ5|GATA_CAUCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gatA PE=3 SV=1 200 356 1.0E-09
sp|Q92QK7|GATA_RHIME Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium meliloti (strain 1021) GN=gatA PE=3 SV=1 203 357 1.0E-09
sp|Q2YU51|GATA_STAAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gatA PE=3 SV=1 203 357 1.0E-09
sp|B8DFG8|GATA_LISMH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gatA PE=3 SV=1 203 357 1.0E-09
sp|A4IVY3|GATA_FRATW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gatA PE=3 SV=1 203 386 1.0E-09
sp|A6UQF6|GATA_METVS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gatA PE=3 SV=1 197 356 1.0E-09
sp|C0QRF9|GATA_PERMH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=gatA PE=3 SV=1 203 356 1.0E-09
sp|Q4KIA8|GATA_PSEF5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gatA PE=3 SV=1 203 356 1.0E-09
sp|C0R074|GATA_BRAHW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=gatA PE=3 SV=1 202 357 1.0E-09
sp|Q2T293|GATA_BURTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gatA PE=3 SV=1 200 356 1.0E-09
sp|P63489|GATA_STAAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain N315) GN=gatA PE=1 SV=1 203 357 1.0E-09
sp|P63488|GATA_STAAM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gatA PE=1 SV=1 203 357 1.0E-09
sp|A7X427|GATA_STAA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gatA PE=3 SV=1 203 357 1.0E-09
sp|A8G4M8|GATA_PROM2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9215) GN=gatA PE=3 SV=1 192 352 1.0E-09
sp|B3Q9W5|GATA_RHOPT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain TIE-1) GN=gatA PE=3 SV=1 175 356 1.0E-09
sp|Q6N575|GATA_RHOPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gatA PE=3 SV=1 175 356 1.0E-09
sp|A8Z2R4|GATA_STAAT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gatA PE=3 SV=1 203 357 1.0E-09
sp|A6QIC8|GATA_STAAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Newman) GN=gatA PE=3 SV=1 203 357 1.0E-09
sp|Q5HEM2|GATA_STAAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain COL) GN=gatA PE=3 SV=1 203 357 1.0E-09
sp|Q2FWY9|GATA_STAA8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain NCTC 8325) GN=gatA PE=3 SV=1 203 357 1.0E-09
sp|Q2FFJ5|GATA_STAA3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain USA300) GN=gatA PE=3 SV=1 203 357 1.0E-09
sp|P52831|HYIN_PSESY Indoleacetamide hydrolase OS=Pseudomonas syringae pv. syringae GN=iaaH PE=3 SV=1 203 411 1.0E-09
sp|Q0BTK2|GATA_GRABC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=gatA PE=3 SV=1 200 356 1.0E-09
sp|Q6GFF7|GATA_STAAR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MRSA252) GN=gatA PE=3 SV=1 203 357 1.0E-09
sp|Q9HVT8|GATA_PSEAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gatA PE=1 SV=1 203 356 1.0E-09
sp|A5EKP4|GATA_BRASB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gatA PE=3 SV=1 183 356 1.0E-09
sp|Q02GV8|GATA_PSEAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gatA PE=3 SV=1 203 356 1.0E-09
sp|B7V023|GATA_PSEA8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain LESB58) GN=gatA PE=3 SV=1 203 356 1.0E-09
sp|Q837V3|GATA_ENTFA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gatA PE=3 SV=1 198 357 1.0E-09
sp|C7YSE7|GATA_NECH7 Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_104567 PE=3 SV=1 200 357 1.0E-09
sp|Q9CJ43|GATA_LACLA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gatA PE=3 SV=1 205 355 1.0E-09
sp|Q8R679|GATA_FUSNN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gatA PE=3 SV=1 203 356 2.0E-09
sp|Q1QVB5|GATA_CHRSD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gatA PE=3 SV=1 211 356 2.0E-09
sp|C1DQ37|GATA_AZOVD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=gatA PE=3 SV=1 203 412 2.0E-09
sp|Q2NHN5|GATA_METST Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=gatA PE=3 SV=1 181 357 2.0E-09
sp|Q8E3P4|GATA_STRA3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gatA PE=3 SV=1 203 356 2.0E-09
sp|Q8DY25|GATA_STRA5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gatA PE=3 SV=1 203 356 2.0E-09
sp|Q3JZM1|GATA_STRA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gatA PE=3 SV=1 203 356 2.0E-09
sp|Q1WSH9|GATA_LACS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus salivarius (strain UCC118) GN=gatA PE=3 SV=1 203 356 2.0E-09
sp|Q5P4D0|GATA_AROAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aromatoleum aromaticum (strain EbN1) GN=gatA PE=3 SV=1 202 352 2.0E-09
sp|Q49YU4|GATA_STAS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gatA PE=3 SV=1 203 356 2.0E-09
sp|C1KW54|GATA_LISMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gatA PE=3 SV=1 203 357 2.0E-09
sp|Q8CRU3|GATA_STAES Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gatA PE=3 SV=1 203 357 2.0E-09
sp|Q5HN34|GATA_STAEQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gatA PE=3 SV=1 203 357 2.0E-09
sp|Q71YR3|GATA_LISMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gatA PE=3 SV=1 203 357 2.0E-09
sp|P22984|AMID_RHOER Amidase OS=Rhodococcus erythropolis GN=amdA PE=1 SV=2 190 356 2.0E-09
sp|A7IMA7|GATA_XANP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gatA PE=3 SV=1 202 356 2.0E-09
sp|A2RHP5|GATA_LACLM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gatA PE=3 SV=1 205 354 2.0E-09
sp|Q8NVT3|GATA_STAAW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MW2) GN=gatA PE=3 SV=1 203 357 2.0E-09
sp|Q6G833|GATA_STAAS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MSSA476) GN=gatA PE=3 SV=1 203 357 2.0E-09
sp|A5IU67|GATA_STAA9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain JH9) GN=gatA PE=3 SV=1 203 357 2.0E-09
sp|A6U305|GATA_STAA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain JH1) GN=gatA PE=3 SV=1 203 357 2.0E-09
sp|B2IEA4|GATA_BEII9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gatA PE=3 SV=1 155 356 2.0E-09
sp|A9VRH7|GATA_BACWK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus weihenstephanensis (strain KBAB4) GN=gatA PE=3 SV=1 203 356 2.0E-09
sp|B4R968|GATA_PHEZH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Phenylobacterium zucineum (strain HLK1) GN=gatA PE=3 SV=1 203 356 2.0E-09
sp|Q032T3|GATA_LACLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gatA PE=3 SV=1 205 354 2.0E-09
sp|A8FAS0|GATA_BACP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus pumilus (strain SAFR-032) GN=gatA PE=3 SV=1 203 357 3.0E-09
sp|Q6FZS9|GATA_BARQU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella quintana (strain Toulouse) GN=gatA PE=3 SV=1 183 357 3.0E-09
sp|B9J1N0|GATA_BACCQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain Q1) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|B7H4W2|GATA_BACC4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain B4264) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|B7IUX9|GATA_BACC2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain G9842) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|Q63GR0|GATA_BACCZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ZK / E33L) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|Q6HP81|GATA_BACHK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|C1EV88|GATA_BACC3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain 03BB102) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|A0R921|GATA_BACAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus thuringiensis (strain Al Hakam) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|Q65MP8|GATA_BACLD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|Q3KI27|GATA_PSEPF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain Pf0-1) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|B7HSY0|GATA_BACC7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain AH187) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|Q73EK8|GATA_BACC1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|B7JMB2|GATA_BACC0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain AH820) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|Q215W8|GATA_RHOPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain BisB18) GN=gatA PE=3 SV=1 202 356 3.0E-09
sp|Q81IN3|GATA_BACCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gatA PE=3 SV=1 203 356 3.0E-09
sp|Q1LSE1|GATA_CUPMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gatA PE=3 SV=1 200 355 4.0E-09
sp|Q891I1|GATA_CLOTE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium tetani (strain Massachusetts / E88) GN=gatA PE=3 SV=1 201 357 4.0E-09
sp|Q81ZE8|GATA_BACAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis GN=gatA PE=3 SV=1 203 356 4.0E-09
sp|C3L559|GATA_BACAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gatA PE=3 SV=1 203 356 4.0E-09
sp|C3PBQ4|GATA_BACAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis (strain A0248) GN=gatA PE=3 SV=1 203 356 4.0E-09
sp|A4JIT0|GATA_BURVG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gatA PE=3 SV=1 184 356 4.0E-09
sp|A3PI90|GATA_RHOS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gatA PE=3 SV=1 203 356 4.0E-09
sp|Q3J459|GATA_RHOS4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gatA PE=3 SV=1 203 356 4.0E-09
sp|B9KPF8|GATA_RHOSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=gatA PE=3 SV=1 203 356 4.0E-09
sp|Q2KU72|GATA_BORA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bordetella avium (strain 197N) GN=gatA PE=3 SV=1 202 355 4.0E-09
sp|Q4L7L4|GATA_STAHJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gatA PE=3 SV=1 203 357 5.0E-09
sp|A6VBJ8|GATA_PSEA7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain PA7) GN=gatA PE=3 SV=1 203 402 5.0E-09
sp|A6U819|GATA_SINMW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sinorhizobium medicae (strain WSM419) GN=gatA PE=3 SV=1 181 357 5.0E-09
sp|Q9RF07|GATA_STAAU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus GN=gatA PE=3 SV=1 203 357 5.0E-09
sp|Q0KFF8|GATA_CUPNH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=gatA PE=3 SV=1 200 355 5.0E-09
sp|B2U7V7|GATA_RALPJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ralstonia pickettii (strain 12J) GN=gatA PE=3 SV=1 200 356 5.0E-09
sp|A4YWF1|GATA_BRASO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bradyrhizobium sp. (strain ORS278) GN=gatA PE=3 SV=1 197 356 5.0E-09
sp|Q2W6Y6|GATA_MAGSA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gatA PE=3 SV=2 200 356 5.0E-09
sp|C5P3I5|GATA_COCP7 Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Coccidioides posadasii (strain C735) GN=CPC735_061260 PE=3 SV=1 203 355 6.0E-09
sp|Q89K29|GATA_BRADU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gatA PE=3 SV=1 197 356 6.0E-09
sp|O27540|GATA_METTH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=gatA PE=3 SV=1 186 357 6.0E-09
sp|B9JVJ1|GATA_AGRVS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gatA PE=3 SV=1 183 357 6.0E-09
sp|Q72DX1|GATA_DESVH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gatA PE=3 SV=1 199 356 6.0E-09
sp|B2G8T6|GATA_LACRJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus reuteri (strain JCM 1112) GN=gatA PE=3 SV=1 198 357 6.0E-09
sp|A5VLG3|GATA_LACRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus reuteri (strain DSM 20016) GN=gatA PE=3 SV=1 198 357 6.0E-09
sp|B2GDS6|GATA_LACF3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=gatA PE=3 SV=1 203 356 7.0E-09
sp|Q9Z9W9|GATA_BACHD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gatA PE=3 SV=1 203 357 7.0E-09
sp|Q47860|HYIN_PANAY Indoleacetamide hydrolase OS=Pantoea agglomerans pv. gypsophilae GN=iaaH PE=3 SV=1 203 370 7.0E-09
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 202 355 8.0E-09
sp|C3K6Y4|GATA_PSEFS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain SBW25) GN=gatA PE=3 SV=1 203 356 8.0E-09
sp|Q38VC9|GATA_LACSS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gatA PE=3 SV=1 203 356 8.0E-09
sp|B2TIZ9|GATA_CLOBB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=gatA PE=3 SV=1 203 357 8.0E-09
sp|A4WUQ2|GATA_RHOS5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gatA PE=3 SV=1 200 356 9.0E-09
sp|B1JDP1|GATA_PSEPW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain W619) GN=gatA PE=3 SV=1 203 411 9.0E-09
sp|B2UZ26|GATA_CLOBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=gatA PE=3 SV=1 203 357 9.0E-09
sp|B6JFW2|GATA_OLICO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gatA PE=3 SV=1 203 356 1.0E-08
sp|P06618|HYIN_PSESS Indoleacetamide hydrolase OS=Pseudomonas savastanoi GN=iaaH PE=3 SV=1 202 411 1.0E-08
sp|Q63YJ9|GATA_BURPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia pseudomallei (strain K96243) GN=gatA PE=3 SV=1 200 356 1.0E-08
sp|A3N4F4|GATA_BURP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia pseudomallei (strain 668) GN=gatA PE=3 SV=1 200 356 1.0E-08
sp|Q3JXC1|GATA_BURP1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia pseudomallei (strain 1710b) GN=gatA PE=3 SV=1 200 356 1.0E-08
sp|A3NQ45|GATA_BURP0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia pseudomallei (strain 1106a) GN=gatA PE=3 SV=1 200 356 1.0E-08
sp|A9WPN2|GATA_RENSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=gatA PE=3 SV=1 203 356 1.0E-08
sp|A1VFG9|GATA_DESVV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gatA PE=3 SV=1 199 356 1.0E-08
sp|B4SCS6|GATA_PELPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gatA PE=3 SV=1 203 355 2.0E-08
sp|Q5WJ20|GATA_BACSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus clausii (strain KSM-K16) GN=gatA PE=3 SV=1 203 356 2.0E-08
sp|Q5M312|GATA_STRT2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gatA PE=3 SV=1 203 356 2.0E-08
sp|Q5LYE9|GATA_STRT1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gatA PE=3 SV=1 203 356 2.0E-08
sp|Q03J81|GATA_STRTD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=gatA PE=3 SV=1 203 356 2.0E-08
sp|B0KQG0|GATA_PSEPG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain GB-1) GN=gatA PE=3 SV=1 203 411 2.0E-08
sp|B2ILX8|GATA_STRPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain CGSP14) GN=gatA PE=3 SV=1 203 352 2.0E-08
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1579 0.108 0.7694 0.0948 0.1731 0.0757 0.2255 0.2732 0.1071 0.0815

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.926798

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5350
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7848
Ophiocordyceps australis map64 (Brazil) OphauB2|6460
Ophiocordyceps subramaniannii Hirsu2|5179
Ophiocordyceps subramaniannii Hirsu2|9768 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9768
MIRAILALSAFPPWRSAVAAHSLVFTGATVKVDDIPYFVSPDAVGRISSNFATRAQGLGLTPVTVLTVNTSSFES
RDLQGQIKRFREVDDVFQDGFLQALIVQQRSSNSKIASPQPFGDSQLYRETFSSDEDELPTGPYFASAQGLLFRA
YRLYADEQGAFSETVISNADGSHSVLAANVQGQSLAVAVPSRLYYTKTAAKPLAGVRLGVKDIFDVKGIKTSNGN
RAWYSLYPPANRTSLAVQRLEDAGAVIVGKMKTSHFALGETATSDWVDYHAPFNPRGDGYQDPSSSSAGPAAGVA
SYPWLDMALGSDTGGSIRSPSQVQGIFGNRPSHGLVSLHDAMPISPEFDTAGLLARDPVLWTRGAQALYGDNLTL
ECSYPSSVLTIGFPTKSSSQLDSLLLDFLGNLTSLLAADAAPLDIDSAWTKSHPRGPALRSFVNNTYEILSAKQQ
ARLVRDPFFADYAAAHDGRLPFVNPAPLKRWAFGESSPSTIEEAVANKTQFMDWFNREVLTRDPASCSKQLLVYV
PRRPAPKYRDTYLAGPALPQPFSTSRLSVLSEAPDMVVPIGQAAYESTVTKHTEHLPVTVDLMAAKGCDGMLFSL
IETLLHRGMIRASRPGRSNVDGGEVLV*
Coding >Hirsu2|9768
ATGATCCGAGCGATTCTCGCTCTTTCGGCTTTTCCGCCGTGGCGGAGCGCCGTGGCTGCGCACTCGCTCGTCTTC
ACCGGTGCAACCGTCAAAGTGGACGACATCCCGTACTTCGTGTCCCCCGATGCAGTCGGAAGGATCTCGAGCAAC
TTCGCCACTCGTGCCCAAGGCCTCGGCCTCACCCCCGTCACCGTCCTCACCGTCAATACGTCGTCCTTTGAATCG
AGGGATCTGCAAGGCCAAATAAAAAGGTTTCGGGAGGTCGACGATGTCTTTCAGGACGGCTTCCTCCAAGCCTTG
ATCGTACAGCAACGAAGCTCAAACTCTAAGATTGCCAGTCCACAACCCTTCGGCGACTCGCAGCTTTACCGGGAA
ACTTTTTCGAGCGACGAGGATGAGCTTCCAACCGGGCCGTACTTTGCCTCAGCTCAAGGCCTTCTCTTCAGGGCG
TACCGACTATACGCGGACGAGCAAGGGGCCTTCAGCGAGACGGTCATCTCGAACGCCGACGGCTCCCACTCGGTG
CTTGCCGCGAATGTTCAAGGCCAGTCGCTTGCCGTGGCGGTCCCGTCACGGTTGTACTACACCAAGACAGCCGCG
AAGCCCCTGGCCGGAGTCCGGCTCGGTGTGAAGGACATCTTTGATGTCAAGGGGATCAAAACCTCCAATGGCAAC
CGGGCTTGGTACAGCTTGTACCCGCCGGCAAACCGGACGTCCCTTGCCGTCCAGCGGCTGGAGGATGCGGGAGCA
GTTATTGTGGGCAAGATGAAGACGAGCCACTTCGCCCTCGGCGAGACTGCCACCTCGGACTGGGTGGACTACCAT
GCGCCCTTCAATCCTCGAGGGGACGGCTATCAAGACCCGTCCTCGTCCTCGGCAGGGCCGGCGGCCGGCGTAGCT
TCGTATCCGTGGCTGGACATGGCCTTGGGTTCCGACACGGGCGGCAGCATCCGAAGCCCTAGCCAGGTACAGGGC
ATCTTTGGAAACAGGCCGAGCCACGGGCTGGTTTCTCTGCACGACGCCATGCCCATCTCGCCCGAGTTCGACACG
GCGGGACTCCTGGCGCGCGACCCCGTGCTCTGGACGCGCGGAGCTCAGGCTCTGTACGGCGACAACTTGACGCTG
GAATGCTCGTACCCGTCCAGCGTACTGACCATTGGGTTCCCGACGAAGTCGTCCTCACAGCTTGACTCACTTCTG
CTGGATTTCCTGGGCAACTTGACAAGCTTGCTCGCCGCAGACGCGGCTCCGCTCGACATTGACTCAGCTTGGACG
AAGAGTCACCCTCGCGGCCCCGCTCTGAGGTCTTTTGTCAATAACACTTACGAAATATTGTCTGCCAAGCAACAA
GCGAGGCTGGTCCGGGATCCCTTCTTCGCCGATTACGCCGCAGCGCACGACGGCAGGCTCCCCTTTGTCAACCCG
GCGCCTCTCAAGCGCTGGGCCTTCGGCGAGAGCTCGCCGTCAACTATCGAGGAGGCCGTCGCGAACAAGACGCAG
TTCATGGACTGGTTCAACCGGGAGGTCCTCACCCGGGACCCTGCGTCGTGCTCCAAGCAGCTCCTGGTTTACGTG
CCTCGGAGACCGGCGCCCAAGTATCGCGACACGTATCTGGCCGGTCCGGCTCTTCCCCAGCCCTTCTCCACAAGC
CGCCTGTCGGTGCTGAGCGAGGCGCCGGATATGGTAGTGCCGATCGGACAGGCGGCATACGAGTCAACGGTGACG
AAGCACACAGAGCACCTCCCCGTAACCGTGGATCTGATGGCCGCCAAGGGATGCGACGGAATGCTGTTCTCGCTC
ATCGAGACACTGCTGCACCGCGGGATGATTAGAGCGAGCCGGCCGGGGAGGAGCAACGTGGACGGGGGCGAGGTT
CTCGTGTAG
Transcript >Hirsu2|9768
ATGATCCGAGCGATTCTCGCTCTTTCGGCTTTTCCGCCGTGGCGGAGCGCCGTGGCTGCGCACTCGCTCGTCTTC
ACCGGTGCAACCGTCAAAGTGGACGACATCCCGTACTTCGTGTCCCCCGATGCAGTCGGAAGGATCTCGAGCAAC
TTCGCCACTCGTGCCCAAGGCCTCGGCCTCACCCCCGTCACCGTCCTCACCGTCAATACGTCGTCCTTTGAATCG
AGGGATCTGCAAGGCCAAATAAAAAGGTTTCGGGAGGTCGACGATGTCTTTCAGGACGGCTTCCTCCAAGCCTTG
ATCGTACAGCAACGAAGCTCAAACTCTAAGATTGCCAGTCCACAACCCTTCGGCGACTCGCAGCTTTACCGGGAA
ACTTTTTCGAGCGACGAGGATGAGCTTCCAACCGGGCCGTACTTTGCCTCAGCTCAAGGCCTTCTCTTCAGGGCG
TACCGACTATACGCGGACGAGCAAGGGGCCTTCAGCGAGACGGTCATCTCGAACGCCGACGGCTCCCACTCGGTG
CTTGCCGCGAATGTTCAAGGCCAGTCGCTTGCCGTGGCGGTCCCGTCACGGTTGTACTACACCAAGACAGCCGCG
AAGCCCCTGGCCGGAGTCCGGCTCGGTGTGAAGGACATCTTTGATGTCAAGGGGATCAAAACCTCCAATGGCAAC
CGGGCTTGGTACAGCTTGTACCCGCCGGCAAACCGGACGTCCCTTGCCGTCCAGCGGCTGGAGGATGCGGGAGCA
GTTATTGTGGGCAAGATGAAGACGAGCCACTTCGCCCTCGGCGAGACTGCCACCTCGGACTGGGTGGACTACCAT
GCGCCCTTCAATCCTCGAGGGGACGGCTATCAAGACCCGTCCTCGTCCTCGGCAGGGCCGGCGGCCGGCGTAGCT
TCGTATCCGTGGCTGGACATGGCCTTGGGTTCCGACACGGGCGGCAGCATCCGAAGCCCTAGCCAGGTACAGGGC
ATCTTTGGAAACAGGCCGAGCCACGGGCTGGTTTCTCTGCACGACGCCATGCCCATCTCGCCCGAGTTCGACACG
GCGGGACTCCTGGCGCGCGACCCCGTGCTCTGGACGCGCGGAGCTCAGGCTCTGTACGGCGACAACTTGACGCTG
GAATGCTCGTACCCGTCCAGCGTACTGACCATTGGGTTCCCGACGAAGTCGTCCTCACAGCTTGACTCACTTCTG
CTGGATTTCCTGGGCAACTTGACAAGCTTGCTCGCCGCAGACGCGGCTCCGCTCGACATTGACTCAGCTTGGACG
AAGAGTCACCCTCGCGGCCCCGCTCTGAGGTCTTTTGTCAATAACACTTACGAAATATTGTCTGCCAAGCAACAA
GCGAGGCTGGTCCGGGATCCCTTCTTCGCCGATTACGCCGCAGCGCACGACGGCAGGCTCCCCTTTGTCAACCCG
GCGCCTCTCAAGCGCTGGGCCTTCGGCGAGAGCTCGCCGTCAACTATCGAGGAGGCCGTCGCGAACAAGACGCAG
TTCATGGACTGGTTCAACCGGGAGGTCCTCACCCGGGACCCTGCGTCGTGCTCCAAGCAGCTCCTGGTTTACGTG
CCTCGGAGACCGGCGCCCAAGTATCGCGACACGTATCTGGCCGGTCCGGCTCTTCCCCAGCCCTTCTCCACAAGC
CGCCTGTCGGTGCTGAGCGAGGCGCCGGATATGGTAGTGCCGATCGGACAGGCGGCATACGAGTCAACGGTGACG
AAGCACACAGAGCACCTCCCCGTAACCGTGGATCTGATGGCCGCCAAGGGATGCGACGGAATGCTGTTCTCGCTC
ATCGAGACACTGCTGCACCGCGGGATGATTAGAGCGAGCCGGCCGGGGAGGAGCAACGTGGACGGGGGCGAGGTT
CTCGTGTAG
Gene >Hirsu2|9768
ATGATCCGAGCGATTCTCGCTCTTTCGGCTTTTCCGCCGTGGCGGAGCGCCGTGGCTGCGCACTCGCTCGTCTTC
ACCGGTGCAACCGTCAAAGTGGACGACATCCCGTACTTCGTGTCCCCCGATGCAGTCGGAAGGATCTCGAGCAAC
TTCGCCACTCGTGCCCAAGGCCTCGGCCTCACCCCCGTCACCGTCCTCACCGTCAATACGTCGTCCTTTGAATCG
AGGGATCTGCAAGGCCAAATAAAAAGGTTTCGGGAGGTCGACGATGTCTTTCAGGACGGCTTCCTCCAAGGTATA
CATGCTCCTGCTATCAAGCCCAGCCGCGGATCTAGGTTCTTCCAACAAATTAGAGGATTGACCTCGCCCGGAGAA
CGGGGACTCTGCGTTTTTTTTTTGTTTTTTTTGCAACAAATACCCAATATTTGAACCTTTCCATCACACAGCCAC
TTACAAAAATCCGTAACGAGGAGAATACCCCAATGATCACAACAACACACCCGAGTGGCGGAATCAAGGCAGCCA
CTGACATCCGCTTTCAGCCTTGATCGTACAGCAACGAAGCTCAAACTCTAAGATTGCCAGTCCACAACCCTTCGG
CGACTCGCAGCTTTACCGGGAAACTTTTTCGAGCGACGAGGATGAGCTTCCAACCGGGCCGTACTTTGCCTCAGC
TCAAGGCCTTCTCTTCAGGGCGTACCGACTATACGCGGACGAGCAAGGGGCCTTCAGCGAGACGGTCATCTCGAA
CGCCGACGGCTCCCACTCGGTGCTTGCCGCGAATGTTCAAGGCCAGTCGCTTGCCGTGGCGGTCCCGTCACGGTT
GTACTACACCAAGACAGCCGCGAAGCCCCTGGCCGGAGTCCGGCTCGGTGTGAAGGACATCTTTGATGTCAAGGG
GATCAAAACCTCCAATGGCAACCGGGCTTGGTACAGCTTGTACCCGCCGGCAAACCGGACGTCCCTTGCCGTCCA
GCGGCTGGAGGATGCGGGAGCAGTTATTGTGGGCAAGATGAAGACGAGCCACTTCGCCCTCGGCGAGACTGCCAC
CTCGGACTGGGTGGACTACCATGCGCCCTTCAATCCTCGAGGGGACGGCTATCAAGACCCGTCCTCGTCCTCGGC
AGGGCCGGCGGCCGGCGTAGGTACGGTTGTACTCCCCCACGCGGCCCTCCAGGGTGCTATCGCTCAGTCACGTCC
ACAGCTTCGTATCCGTGGCTGGACATGGCCTTGGGTTCCGACACGGGCGGCAGCATCCGAAGCCCTAGCCAGGTA
CAGGGCATCTTTGGAAACAGGCCGAGTAAGCGCAGCATCTTGACGCGAAGCAGACCTGCCACTCAGGCGCTGACC
GGAGCAGGCCACGGGCTGGTTTCTCTGCACGACGCCATGCCCATCTCGCCCGAGTTCGACACGGCGGGACTCCTG
GCGCGCGACCCCGTGCTCTGGACGCGCGGAGCTCAGGCTCTGTACGGCGACAACTTGACGCTGGAATGCTCGTAC
CCGTCCAGCGTACTGACCATTGGGTTCCCGACGAAGTCGTCCTCACAGCTTGACTCACTTCTGCTGGATTTCCTG
GGCAACTTGACAAGCTTGCTCGCCGCAGACGCGGCTCCGCTCGACATTGACTCAGCTTGGACGAAGAGTCACCCT
CGCGGCCCCGCTCTGAGGTCTTTTGTCAATAACACTTACGAAATATTGTCTGCCAAGCAACAAGCGAGGCTGGTC
CGGGATCCCTTCTTCGCCGATTACGCCGCAGCGCACGACGGCAGGCTCCCCTTTGTCAACCCGGCGCCTCTCAAG
CGCTGGGCCTTCGGCGAGAGCTCGCCGTCAACTATCGAGGAGGCCGTCGCGAACAAGACGCAGTTCATGGACTGG
TTCAACCGGGAGGTCCTCACCCGGGACCCTGCGTCGTGCTCCAAGCAGCTCCTGGTTTACGTGCCTCGGAGACCG
GCGCCCAAGTATCGCGACACGTATCTGGCCGGTCCGGCTCTTCCCCAGCCCTTCTCCACAAGCCGCCTGTCGGTG
CTGAGCGAGGCGCCGGATATGGTAGTGCCGATCGGACAGGCGGCATACGAGTCAACGGTGACGAAGCACACAGAG
CACCTCCCCGTAACCGTGGATCTGATGGCCGCCAAGGGATGCGACGGAATGCTGTTCTCGCTCATCGAGACACTG
CTGCACCGCGGGATGATTAGAGCGAGCCGGCCGGGGAGGAGCAACGTGGACGGGGGCGAGGTTCTCGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail