Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9767
Gene name
LocationContig_734:3293..5051
Strand-
Gene length (bp)1758
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 9.3E-33 67 559
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.3E-06 62 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23623|OXLA_NEUCR L-amino-acid oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lox PE=1 SV=2 37 581 2.0E-108
sp|P86810|OXLA_SIGCA L-amino-acid oxidase OS=Siganus canaliculatus PE=1 SV=2 60 565 3.0E-20
sp|O34363|YOBN_BACSU Putative L-amino-acid oxidase YobN OS=Bacillus subtilis (strain 168) GN=yobN PE=3 SV=3 60 559 4.0E-20
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 16 553 2.0E-18
sp|A6MFL0|OXLA_DEMVE L-amino-acid oxidase OS=Demansia vestigiata PE=2 SV=1 11 556 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23623|OXLA_NEUCR L-amino-acid oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lox PE=1 SV=2 37 581 2.0E-108
sp|P86810|OXLA_SIGCA L-amino-acid oxidase OS=Siganus canaliculatus PE=1 SV=2 60 565 3.0E-20
sp|O34363|YOBN_BACSU Putative L-amino-acid oxidase YobN OS=Bacillus subtilis (strain 168) GN=yobN PE=3 SV=3 60 559 4.0E-20
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 16 553 2.0E-18
sp|A6MFL0|OXLA_DEMVE L-amino-acid oxidase OS=Demansia vestigiata PE=2 SV=1 11 556 2.0E-18
sp|Q54EW2|Y9130_DICDI Putative bifunctional amine oxidase DDB_G0291301 OS=Dictyostelium discoideum GN=DDB_G0291301 PE=1 SV=1 50 576 4.0E-18
sp|B5U6Y8|OXLA_ECHOC L-amino-acid oxidase OS=Echis ocellatus PE=1 SV=1 60 553 3.0E-17
sp|Q6STF1|OXLA_GLOHA L-amino-acid oxidase OS=Gloydius halys PE=1 SV=1 60 556 3.0E-17
sp|X2JCV5|OXLA_CERCE L-amino acid oxidase OS=Cerastes cerastes PE=1 SV=1 11 556 5.0E-17
sp|Q90W54|OXLA_GLOBL L-amino-acid oxidase OS=Gloydius blomhoffii PE=1 SV=1 11 556 1.0E-16
sp|A8QL52|OXLA_BUNFA L-amino-acid oxidase OS=Bungarus fasciatus PE=1 SV=1 60 556 9.0E-16
sp|Q6TGQ9|OXLA_BOTJR L-amino-acid oxidase (Fragment) OS=Bothrops jararacussu PE=1 SV=1 50 555 3.0E-15
sp|Q4JHE2|OXLA_NOTSC L-amino-acid oxidase OS=Notechis scutatus scutatus PE=2 SV=1 11 556 3.0E-14
sp|P81383|OXLA_OPHHA L-amino-acid oxidase OS=Ophiophagus hannah PE=1 SV=3 279 559 5.0E-13
sp|Q8KHS0|REBO_NOCAE Flavin-dependent L-tryptophan oxidase RebO OS=Lechevalieria aerocolonigenes GN=rebO PE=1 SV=1 300 553 2.0E-10
sp|Q96RQ9|OXLA_HUMAN L-amino-acid oxidase OS=Homo sapiens GN=IL4I1 PE=1 SV=1 382 559 3.0E-10
sp|O09046|OXLA_MOUSE L-amino-acid oxidase OS=Mus musculus GN=Il4i1 PE=1 SV=1 382 575 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9767
MRRLVLTASVACLCAAAPDDGADRERGPLLQDFDALGAWFDGVAAIPSPSTTRVPPNVSIAIVGGGITGLATAMM
LDSVGLHNWELIEASDRVGGRFRTKFVGGTQEWAEMGPMRLPYAVTYKSDNSTHQYTDHQMTFQLAELLNEMNKD
EPGLRIDFIPWIQHHANELIARGTGRHPDGRVPTRAEIAADPRLGRPAPLSTAEYGETKAKMQRILMSEARLRSI
QRDPWRAHRRAMDEGLDDWSEQAMMRHAFNASDDVTDAIWTASDYDVFWDEMVHNSNLAQDGGAGALGETDWRCV
DGGFNRMTDAFLPHVRDRLRLGRKVTRLEPVRRQPDGRTRTRLWWRPAAGNGTGRRPESGEYDYTIMTAPFTMTR
FMDLPAFSSVLSRAMSEQGLRFKSACKVSLLFRERFWERGPRPIFGGYSMPASLAVGALYYPVYGLGEPGRPGLI
THYRGGDWSDRFVSLTDAQHADLVLDAVADLHGDEARQLYTGHFERLCWLQDEHAAAAWCRPDVEQHRLYMPAYH
RTEHNTIFVGEHTAPTHAWISSSLHSAVRGSVQLLLELGLVDQAKQLNEQWMGRWIGRGG*
Coding >Hirsu2|9767
ATGAGGAGGCTGGTTCTCACAGCATCCGTTGCCTGTCTCTGCGCGGCCGCGCCTGACGATGGCGCCGACCGGGAG
AGAGGGCCGCTGCTGCAAGACTTTGACGCTCTCGGGGCGTGGTTCGACGGCGTAGCAGCGATCCCGAGCCCGTCG
ACGACGCGGGTGCCGCCCAACGTCAGCATCGCCATCGTGGGCGGCGGCATCACGGGCCTGGCGACGGCCATGATG
CTCGACAGCGTCGGGCTGCACAACTGGGAGCTGATCGAGGCCAGCGACCGGGTCGGCGGGCGGTTCCGGACCAAG
TTCGTGGGCGGGACGCAGGAATGGGCTGAGATGGGGCCCATGAGGCTGCCGTACGCCGTCACGTACAAGAGCGAC
AACTCGACGCACCAGTACACGGACCACCAGATGACCTTCCAGCTGGCCGAGCTGCTCAACGAGATGAACAAGGAC
GAGCCGGGGCTCCGGATCGACTTCATCCCCTGGATCCAGCACCACGCCAACGAGCTCATCGCGCGCGGTACCGGC
CGGCACCCGGACGGCCGGGTGCCGACCCGGGCCGAGATCGCGGCGGACCCGAGGCTGGGCCGGCCGGCGCCGCTG
TCGACGGCCGAGTACGGCGAGACCAAGGCCAAGATGCAGCGGATCCTGATGAGCGAGGCCCGGCTGCGGTCGATC
CAGCGCGACCCCTGGCGGGCGCACCGGCGGGCCATGGACGAGGGCCTGGACGACTGGAGCGAGCAGGCCATGATG
CGGCACGCCTTCAACGCCAGCGACGACGTGACCGACGCCATCTGGACCGCGTCCGACTACGACGTCTTCTGGGAC
GAGATGGTGCACAACTCCAACCTGGCCCAGGACGGCGGCGCCGGCGCCCTGGGCGAGACGGACTGGAGGTGCGTC
GACGGCGGCTTCAACCGCATGACGGACGCCTTCCTGCCGCATGTCCGCGACCGGCTCCGGCTAGGGCGCAAGGTC
ACGAGGCTGGAGCCGGTGCGGCGGCAGCCCGACGGCCGGACCCGGACCCGGCTCTGGTGGCGGCCGGCGGCGGGC
AACGGCACCGGGCGGCGGCCCGAGTCGGGCGAGTACGACTACACCATCATGACGGCGCCCTTCACCATGACGCGC
TTCATGGACCTGCCGGCCTTCTCGTCCGTGCTGAGCCGGGCCATGAGCGAGCAGGGCCTGCGCTTCAAGTCGGCC
TGCAAGGTGTCGCTGCTGTTCCGCGAGCGCTTCTGGGAGCGCGGCCCGCGGCCCATCTTCGGCGGCTACTCCATG
CCGGCCAGCCTGGCCGTCGGCGCCCTCTACTACCCGGTCTACGGCCTGGGCGAGCCGGGCCGGCCGGGCCTGATC
ACCCACTACCGCGGCGGCGACTGGAGCGACCGCTTCGTCAGCCTGACGGACGCCCAGCACGCCGACCTGGTGCTC
GACGCCGTCGCCGACCTGCACGGCGACGAGGCCCGCCAACTCTACACCGGCCACTTCGAGCGCCTCTGCTGGCTG
CAGGACGAGCACGCCGCCGCCGCCTGGTGCCGGCCCGACGTCGAGCAGCACCGGTTGTACATGCCGGCCTATCAC
CGCACTGAGCACAACACCATCTTTGTCGGCGAGCACACGGCCCCGACCCACGCCTGGATCAGCTCCTCGCTGCAC
TCCGCCGTTCGCGGCTCCGTCCAGCTCCTGCTCGAGCTCGGCCTCGTCGACCAGGCCAAGCAGCTGAACGAGCAG
TGGATGGGCAGGTGGATCGGCCGCGGCGGCTGA
Transcript >Hirsu2|9767
ATGAGGAGGCTGGTTCTCACAGCATCCGTTGCCTGTCTCTGCGCGGCCGCGCCTGACGATGGCGCCGACCGGGAG
AGAGGGCCGCTGCTGCAAGACTTTGACGCTCTCGGGGCGTGGTTCGACGGCGTAGCAGCGATCCCGAGCCCGTCG
ACGACGCGGGTGCCGCCCAACGTCAGCATCGCCATCGTGGGCGGCGGCATCACGGGCCTGGCGACGGCCATGATG
CTCGACAGCGTCGGGCTGCACAACTGGGAGCTGATCGAGGCCAGCGACCGGGTCGGCGGGCGGTTCCGGACCAAG
TTCGTGGGCGGGACGCAGGAATGGGCTGAGATGGGGCCCATGAGGCTGCCGTACGCCGTCACGTACAAGAGCGAC
AACTCGACGCACCAGTACACGGACCACCAGATGACCTTCCAGCTGGCCGAGCTGCTCAACGAGATGAACAAGGAC
GAGCCGGGGCTCCGGATCGACTTCATCCCCTGGATCCAGCACCACGCCAACGAGCTCATCGCGCGCGGTACCGGC
CGGCACCCGGACGGCCGGGTGCCGACCCGGGCCGAGATCGCGGCGGACCCGAGGCTGGGCCGGCCGGCGCCGCTG
TCGACGGCCGAGTACGGCGAGACCAAGGCCAAGATGCAGCGGATCCTGATGAGCGAGGCCCGGCTGCGGTCGATC
CAGCGCGACCCCTGGCGGGCGCACCGGCGGGCCATGGACGAGGGCCTGGACGACTGGAGCGAGCAGGCCATGATG
CGGCACGCCTTCAACGCCAGCGACGACGTGACCGACGCCATCTGGACCGCGTCCGACTACGACGTCTTCTGGGAC
GAGATGGTGCACAACTCCAACCTGGCCCAGGACGGCGGCGCCGGCGCCCTGGGCGAGACGGACTGGAGGTGCGTC
GACGGCGGCTTCAACCGCATGACGGACGCCTTCCTGCCGCATGTCCGCGACCGGCTCCGGCTAGGGCGCAAGGTC
ACGAGGCTGGAGCCGGTGCGGCGGCAGCCCGACGGCCGGACCCGGACCCGGCTCTGGTGGCGGCCGGCGGCGGGC
AACGGCACCGGGCGGCGGCCCGAGTCGGGCGAGTACGACTACACCATCATGACGGCGCCCTTCACCATGACGCGC
TTCATGGACCTGCCGGCCTTCTCGTCCGTGCTGAGCCGGGCCATGAGCGAGCAGGGCCTGCGCTTCAAGTCGGCC
TGCAAGGTGTCGCTGCTGTTCCGCGAGCGCTTCTGGGAGCGCGGCCCGCGGCCCATCTTCGGCGGCTACTCCATG
CCGGCCAGCCTGGCCGTCGGCGCCCTCTACTACCCGGTCTACGGCCTGGGCGAGCCGGGCCGGCCGGGCCTGATC
ACCCACTACCGCGGCGGCGACTGGAGCGACCGCTTCGTCAGCCTGACGGACGCCCAGCACGCCGACCTGGTGCTC
GACGCCGTCGCCGACCTGCACGGCGACGAGGCCCGCCAACTCTACACCGGCCACTTCGAGCGCCTCTGCTGGCTG
CAGGACGAGCACGCCGCCGCCGCCTGGTGCCGGCCCGACGTCGAGCAGCACCGGTTGTACATGCCGGCCTATCAC
CGCACTGAGCACAACACCATCTTTGTCGGCGAGCACACGGCCCCGACCCACGCCTGGATCAGCTCCTCGCTGCAC
TCCGCCGTTCGCGGCTCCGTCCAGCTCCTGCTCGAGCTCGGCCTCGTCGACCAGGCCAAGCAGCTGAACGAGCAG
TGGATGGGCAGGTGGATCGGCCGCGGCGGCTGA
Gene >Hirsu2|9767
ATGAGGAGGCTGGTTCTCACAGCATCCGTTGCCTGTCTCTGCGCGGCCGCGCCTGACGATGGCGCCGACCGGGAG
AGAGGGCCGCTGCTGCAAGACTTTGACGCTCTCGGGGCGTGGTTCGACGGCGTAGCAGCGATCCCGAGCCCGTCG
ACGACGCGGGTGCCGCCCAACGTCAGCATCGCCATCGTGGGCGGCGGCATCACGGGCCTGGCGACGGCCATGATG
CTCGACAGCGTCGGGCTGCACAACTGGGAGCTGATCGAGGCCAGCGACCGGGTCGGCGGGCGGTTCCGGACCAAG
TTCGTGGGCGGGACGCAGGAATGGGCTGAGATGGGGCCCATGAGGCTGCCGTACGCCGTCACGTACAAGAGCGAC
AACTCGACGCACCAGTACACGGACCACCAGATGACCTTCCAGCTGGCCGAGCTGCTCAACGAGATGAACAAGGAC
GAGCCGGGGCTCCGGATCGACTTCATCCCCTGGATCCAGCACCACGCCAACGAGCTCATCGCGCGCGGTACCGGC
CGGCACCCGGACGGCCGGGTGCCGACCCGGGCCGAGATCGCGGCGGACCCGAGGCTGGGCCGGCCGGCGCCGCTG
TCGACGGCCGAGTACGGCGAGACCAAGGCCAAGATGCAGCGGATCCTGATGAGCGAGGCCCGGCTGCGGTCGATC
CAGCGCGACCCCTGGCGGGCGCACCGGCGGGCCATGGACGAGGGCCTGGACGACTGGAGCGAGCAGGCCATGATG
CGGCACGCCTTCAACGCCAGCGACGACGTGACCGACGCCATCTGGACCGCGTCCGACTACGACGTCTTCTGGGAC
GAGATGGTGCACAACTCCAACCTGGCCCAGGACGGCGGCGCCGGCGCCCTGGGCGAGACGGACTGGAGGTGCGTC
GACGGCGGCTTCAACCGCATGACGGACGCCTTCCTGCCGCATGTCCGCGACCGGCTCCGGCTAGGGCGCAAGGTC
ACGAGGCTGGAGCCGGTGCGGCGGCAGCCCGACGGCCGGACCCGGACCCGGCTCTGGTGGCGGCCGGCGGCGGGC
AACGGCACCGGGCGGCGGCCCGAGTCGGGCGAGTACGACTACACCATCATGACGGCGCCCTTCACCATGACGCGC
TTCATGGACCTGCCGGCCTTCTCGTCCGTGCTGAGCCGGGCCATGAGCGAGCAGGGCCTGCGCTTCAAGTCGGCC
TGCAAGGTGTCGCTGCTGTTCCGCGAGCGCTTCTGGGAGCGCGGCCCGCGGCCCATCTTCGGCGGCTACTCCATG
CCGGCCAGCCTGGCCGTCGGCGCCCTCTACTACCCGGTCTACGGCCTGGGCGAGCCGGGCCGGCCGGGCCTGATC
ACCCACTACCGCGGCGGCGACTGGAGCGACCGCTTCGTCAGCCTGACGGACGCCCAGCACGCCGACCTGGTGCTC
GACGCCGTCGCCGACCTGCACGGCGACGAGGCCCGCCAACTCTACACCGGCCACTTCGAGCGCCTCTGCTGGCTG
CAGGACGAGCACGCCGCCGCCGCCTGGTGCCGGCCCGACGTCGAGCAGCACCGGTTGTACATGCCGGCCTATCAC
CGCACTGAGCACAACACCATCTTTGTCGGCGAGCACACGGCCCCGACCCACGCCTGGATCAGCTCCTCGCTGCAC
TCCGCCGTTCGCGGCTCCGTCCAGCTCCTGCTCGAGCTCGGCCTCGTCGACCAGGCCAAGCAGCTGAACGAGCAG
TGGATGGGCAGGTGGATCGGCCGCGGCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail