Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9766
Gene name
LocationContig_734:628..3038
Strand+
Gene length (bp)2410
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 5.1E-33 69 492
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.1E-07 71 99
PF00890 FAD_binding_2 FAD binding domain 1.4E-04 69 108

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O43029|FAP1_SCHPO L-pipecolate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap1 PE=1 SV=1 63 526 6.0E-33
sp|Q9UTM9|FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap2 PE=1 SV=1 67 512 3.0E-31
sp|P40854|MSOX_STRSB Monomeric sarcosine oxidase OS=Streptomyces sp. (strain KB210-8SY) GN=soxA PE=1 SV=2 63 492 7.0E-08

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9766
MPPRLLQQPPQYQDLESIDSGTRLASSNLLRQSQCGGIVDSDALGRSAAVSSASQVRPGISMMASPRSVAIVGAG
VFGLSIALALRKRGYRVVVFDQEPYDSTAYAPSDDGLSQAASVDHNKIFRASYGTKLHYQRLALDSRAAWLALDA
GRLLSPCGMLRVQPTGELGSLERETLAGLARDGLRDTQFVRGDAADRARAVDEGWDAKLLAFCDAEGRALEAVLD
SLAGFVRCSDACAFVQRSAASEGVEFRFGPEEGAFDSLVEETESSSSSSSSTPQKRVIGLKTKDGTFHPADTVVI
AAGSYSTQLLPELAYHLESSAGSLATFRIDRSERALWDKYAPDRFPVITWKSAPRAQDGRDMGSVYALPRTPEGL
VKIGYRGIKFTNFQPAPAGAPFTQQGEWSVPLPRAECSRIPPPAEEAIRTFVSLFLPEFRDVPFYSQRLCWYTDS
LDNSFLIDYVPVYADRSVFVCAGGSGHGAKFLPVLGEHAADIFEHGDASASFMRPFWRWRPDAPRRNGLDEGPDG
PRNLARMGDWRRAGP*
Coding >Hirsu2|9766
ATGCCTCCTCGCCTGCTCCAGCAGCCGCCACAATACCAGGACCTGGAGAGCATCGACTCCGGGACCCGCCTTGCC
TCGTCCAACCTGCTGCGGCAAAGCCAGTGCGGAGGCATCGTCGACTCCGACGCCCTTGGCCGCTCCGCCGCCGTC
TCTTCCGCTTCGCAGGTCCGGCCGGGCATCTCCATGATGGCGAGCCCCCGATCAGTCGCCATCGTCGGCGCCGGC
GTCTTCGGTCTCTCGATAGCCCTCGCGCTGCGCAAGAGGGGCTACCGCGTCGTCGTCTTCGATCAGGAGCCCTAC
GATTCGACGGCCTACGCGCCCTCAGACGATGGCCTATCGCAAGCCGCCTCGGTCGACCACAATAAGATCTTCCGC
GCCTCGTACGGCACCAAGCTGCACTACCAGCGCCTCGCGCTCGACAGCCGCGCCGCCTGGCTTGCCCTCGACGCC
GGCCGCCTCCTTTCGCCCTGCGGCATGTTGCGCGTGCAGCCGACGGGCGAGCTGGGCTCTTTGGAGCGCGAGACG
CTGGCTGGGCTGGCGCGCGACGGCCTGCGCGACACGCAGTTCGTGCGCGGCGACGCGGCCGACCGCGCACGCGCG
GTCGACGAGGGCTGGGACGCCAAGCTCCTGGCCTTCTGCGATGCCGAAGGCCGCGCTCTCGAGGCCGTGCTTGAC
TCACTTGCCGGCTTTGTCCGCTGTTCGGACGCCTGTGCCTTCGTCCAGCGGAGCGCCGCTTCGGAAGGTGTCGAG
TTTCGCTTTGGGCCCGAAGAGGGCGCCTTTGACTCGCTCGTTGAGGAGACGGAATCTTCTTCGTCATCGTCGTCA
TCCACGCCTCAGAAGAGAGTCATCGGCCTCAAGACCAAAGACGGCACGTTCCACCCAGCAGACACGGTCGTCATC
GCAGCCGGATCCTACTCGACCCAGCTCCTGCCTGAGCTCGCCTACCATCTCGAGTCTTCGGCCGGCAGCCTGGCC
ACCTTCAGGATCGACCGCAGCGAGCGCGCCCTCTGGGACAAGTACGCCCCCGACCGCTTCCCCGTCATCACCTGG
AAGAGCGCGCCGCGGGCCCAGGACGGGCGGGACATGGGAAGCGTCTACGCCCTGCCACGGACGCCCGAGGGCCTC
GTCAAGATCGGCTACCGCGGCATAAAGTTTACCAACTTCCAGCCGGCGCCCGCCGGCGCCCCCTTCACCCAGCAG
GGCGAATGGTCCGTCCCGCTCCCGAGGGCGGAATGCAGCCGGATTCCCCCGCCTGCGGAGGAGGCCATCCGGACG
TTCGTCTCGCTCTTCCTCCCGGAATTCCGCGACGTCCCCTTCTATTCGCAGCGGCTATGCTGGTACACCGACTCA
CTGGACAACTCGTTCCTGATCGACTACGTGCCCGTGTACGCGGACCGATCCGTCTTCGTCTGCGCCGGCGGCAGC
GGCCACGGCGCCAAGTTCTTGCCCGTCCTGGGAGAGCACGCGGCCGACATCTTCGAGCACGGCGACGCGAGCGCG
TCCTTCATGCGTCCCTTCTGGCGATGGCGGCCAGATGCCCCGCGGCGCAACGGCCTGGACGAGGGCCCGGATGGA
CCTCGAAACCTGGCCCGCATGGGAGACTGGAGGAGGGCCGGGCCGTGA
Transcript >Hirsu2|9766
ATGCCTCCTCGCCTGCTCCAGCAGCCGCCACAATACCAGGACCTGGAGAGCATCGACTCCGGGACCCGCCTTGCC
TCGTCCAACCTGCTGCGGCAAAGCCAGTGCGGAGGCATCGTCGACTCCGACGCCCTTGGCCGCTCCGCCGCCGTC
TCTTCCGCTTCGCAGGTCCGGCCGGGCATCTCCATGATGGCGAGCCCCCGATCAGTCGCCATCGTCGGCGCCGGC
GTCTTCGGTCTCTCGATAGCCCTCGCGCTGCGCAAGAGGGGCTACCGCGTCGTCGTCTTCGATCAGGAGCCCTAC
GATTCGACGGCCTACGCGCCCTCAGACGATGGCCTATCGCAAGCCGCCTCGGTCGACCACAATAAGATCTTCCGC
GCCTCGTACGGCACCAAGCTGCACTACCAGCGCCTCGCGCTCGACAGCCGCGCCGCCTGGCTTGCCCTCGACGCC
GGCCGCCTCCTTTCGCCCTGCGGCATGTTGCGCGTGCAGCCGACGGGCGAGCTGGGCTCTTTGGAGCGCGAGACG
CTGGCTGGGCTGGCGCGCGACGGCCTGCGCGACACGCAGTTCGTGCGCGGCGACGCGGCCGACCGCGCACGCGCG
GTCGACGAGGGCTGGGACGCCAAGCTCCTGGCCTTCTGCGATGCCGAAGGCCGCGCTCTCGAGGCCGTGCTTGAC
TCACTTGCCGGCTTTGTCCGCTGTTCGGACGCCTGTGCCTTCGTCCAGCGGAGCGCCGCTTCGGAAGGTGTCGAG
TTTCGCTTTGGGCCCGAAGAGGGCGCCTTTGACTCGCTCGTTGAGGAGACGGAATCTTCTTCGTCATCGTCGTCA
TCCACGCCTCAGAAGAGAGTCATCGGCCTCAAGACCAAAGACGGCACGTTCCACCCAGCAGACACGGTCGTCATC
GCAGCCGGATCCTACTCGACCCAGCTCCTGCCTGAGCTCGCCTACCATCTCGAGTCTTCGGCCGGCAGCCTGGCC
ACCTTCAGGATCGACCGCAGCGAGCGCGCCCTCTGGGACAAGTACGCCCCCGACCGCTTCCCCGTCATCACCTGG
AAGAGCGCGCCGCGGGCCCAGGACGGGCGGGACATGGGAAGCGTCTACGCCCTGCCACGGACGCCCGAGGGCCTC
GTCAAGATCGGCTACCGCGGCATAAAGTTTACCAACTTCCAGCCGGCGCCCGCCGGCGCCCCCTTCACCCAGCAG
GGCGAATGGTCCGTCCCGCTCCCGAGGGCGGAATGCAGCCGGATTCCCCCGCCTGCGGAGGAGGCCATCCGGACG
TTCGTCTCGCTCTTCCTCCCGGAATTCCGCGACGTCCCCTTCTATTCGCAGCGGCTATGCTGGTACACCGACTCA
CTGGACAACTCGTTCCTGATCGACTACGTGCCCGTGTACGCGGACCGATCCGTCTTCGTCTGCGCCGGCGGCAGC
GGCCACGGCGCCAAGTTCTTGCCCGTCCTGGGAGAGCACGCGGCCGACATCTTCGAGCACGGCGACGCGAGCGCG
TCCTTCATGCGTCCCTTCTGGCGATGGCGGCCAGATGCCCCGCGGCGCAACGGCCTGGACGAGGGCCCGGATGGA
CCTCGAAACCTGGCCCGCATGGGAGACTGGAGGAGGGCCGGGCCGTGA
Gene >Hirsu2|9766
ATGCCTCCTCGCCTGCTCCAGCAGCCGCCACAATACCAGGACCTGGAGAGCATCGACTCCGGGAGTAAAGCTGGA
TACCCTACCTTCTTTCTATCAGCGAACCAAGCGAACCTTCACATGACTGCCCCCTGCGCAGACACGGGAGCTTAG
GCGGCCGGCCCCGGTGTCCCTGCAGCTTCACGGCAACCGACCTCGGCTCGCCAGCCCGCCTTGCCTCGTCCAACC
TGCTGCGGCAAAGCCAGTGCGGAGGCATCGTCGACTCCGACGCCCTTGGCCGCTCCGCCGCCGTCTCTTCCGCTT
CGCAGGTCCGGCCGGGCATCTCCATGATGGCGAGCCCCCGATCAGTCGCCATCGTCGGCGGTGAGCCGTCCATCT
GTCTGCTTCCTCCCCCGCTCCGGCTGAAGCGCAGATATAGCCGGCGTCTTCGGTCTCTCGATAGCCCTCGCGCTG
CGCAAGAGGGGTCAGTCTCAGTCTCTCTCTTCTTCCCTCTCTCTCTCTTTGCCACTATGTCTCTAGCGGTCCGTC
CATCTCCATCCCCATCTGTCTCTTTGTCTCTGTCTTTCTCTGTCTCTCTCTCTCCAAAGGGGTGCTGAGCAGAGA
GAGGGAGAGAGGGCGCAGGCTACCGCGTCGTCGTCTTCGATCAGGAGCCCTACGATTCGACGGCCTACGCGCCCT
CAGACGATGGCCTATCGCAAGCCGCCTCGGTCGACCACAATAAGATCGTAAGCGCGCTGTCCCCTTCTCCCCGAG
ATATCACGCCGGAAAAGGGCTTCTCTGTCCTCTTCCCGTGCTCACTCTGAGATGACTCGCCGGATAAAAGTTCCG
CGCCTCGTACGGCACCAAGCTGCACTACCAGCGCCTCGCGCTCGACAGCCGCGCCGCCTGGCTTGCCCTCGACGC
CGGCCGCCTCCTTTCGCCCTGCGGCATGTTGCGCGTGCAGCCGACGGGCGAGCTGGGCTCTTTGGAGCGCGAGAC
GCTGGCTGGGCTGGCGCGCGACGGCCTGCGCGACACGCAGTTCGTGCGCGGCGACGCGGCCGACCGCGCACGCGC
GGTCGACGAGGGCTGGGACGCCAAGCTCCTGGCCTTCTGCGATGCCGAAGGCCGCGCTCTCGAGGCCGTGCTTGA
CTCACTTGCCGGCTTTGTCCGCTGTTCGGACGCCTGTGCCTTCGTCCAGCGGAGCGCCGCTTCGGAAGGTGTCGA
GTTTCGCTTTGGGCCCGAAGAGGGCGCCTTTGACTCGCTCGTTGAGGAGACGGAATCTTCTTCGTCATCGTCGTC
ATCCACGCCTCAGAAGAGAGTCATCGGCCTCAAGACCAAAGACGGCACGTTCCACCCAGCAGACACGGTCGTCAT
CGCAGGTGAGGCCATAAACCACAGACGGGACCACCATCAACGACATCACTCACGCCTCTCCACTAACCCTGCCCC
CCTCAAAAAAAGCCGGATCCTACTCGACCCAGCTCCTGCCTGAGCTCGCCTACCATCTCGAGTCTTCGGCCGGCA
GCCTGGCCACCTTCAGGATCGACCGCAGCGAGCGCGCCCTCTGGGACAAGTACGCCCCCGACCGCTTCCCCGTCA
TCACCTGGAAGAGCGCGCCGCGGGCCCAGGACGGGCGGGACATGGGAAGCGTCTACGCCCTGCCACGGACGCCCG
AGGGCCTCGTCAAGATCGGCTACCGCGGCATAAAGGCGAGCCTCCACGGTGGCCTCTGGCCCCATTATCCACCCC
TATCTGAGGAGTCGGGACGAGAGCCTCCTTGCTGACCCCAGGCCTCTCGACTGACAGTTTACCAACTTCCAGCCG
GCGCCCGCCGGCGCCCCCTTCACCCAGCAGGGCGAATGGTCCGTCCCGCTCCCGAGGGCGGAATGCAGCCGGATT
CCCCCGCCTGCGGAGGAGGCCATCCGGACGTTCGTCTCGCTCTTCCTCCCGGAATTCCGCGACGTCCCCTTCTAT
TCGCAGCGGCTATGCTGGTACACCGACTCACTGGACAACTCGTTCCTGGTTCGCCCCTTCTCCCCTCCTTCTGCT
CGGCAGATGAGATAGATAGATGCGCTGACGGCTTGGGGATGGCGAGTCAAGATCGACTACGTGCCCGTGTACGCG
GACCGATCCGTCTTCGTCTGCGCCGGCGGCAGCGGCCACGGCGCCAAGTTCTTGCCCGTCCTGGGAGAGGTGCGC
TTCTATACGCCGTTTTGGAACCGAGGGGAGGTCGGACGTGAAGCTGACCCGGGGGAGTCGCGCCTGGGCGCAGCA
CGCGGCCGACATCTTCGAGCACGGCGACGCGAGCGCGTCCTTCATGCGTCCCTTCTGGCGATGGCGGCCAGATGC
CCCGCGGCGCAACGGCCTGGACGAGGGCCCGGATGGACCTCGAAACCTGGCCCGCATGGGAGACTGGAGGAGGGC
CGGGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail