Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9757
Gene name
LocationContig_732:5929..6955
Strand+
Gene length (bp)1026
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07519 Tannase Tannase and feruloyl esterase 3.2E-69 1 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DMV3|FAEB2_NEOFI Probable feruloyl esterase B-2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=faeB-2 PE=3 SV=1 4 329 4.0E-103
sp|Q0CVS2|FAEB1_ASPTN Probable feruloyl esterase B-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeB-1 PE=3 SV=1 3 329 5.0E-102
sp|Q4WMR0|FAEB2_ASPFU Probable feruloyl esterase B-2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=faeB-2 PE=3 SV=1 4 329 7.0E-102
sp|Q2UMX6|FAEB2_ASPOR Probable feruloyl esterase B-2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeB-2 PE=3 SV=1 3 329 7.0E-102
sp|B8NPA4|FAEB1_ASPFN Probable feruloyl esterase B-1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeB-1 PE=3 SV=1 3 329 8.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DMV3|FAEB2_NEOFI Probable feruloyl esterase B-2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=faeB-2 PE=3 SV=1 4 329 4.0E-103
sp|Q0CVS2|FAEB1_ASPTN Probable feruloyl esterase B-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeB-1 PE=3 SV=1 3 329 5.0E-102
sp|Q4WMR0|FAEB2_ASPFU Probable feruloyl esterase B-2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=faeB-2 PE=3 SV=1 4 329 7.0E-102
sp|Q2UMX6|FAEB2_ASPOR Probable feruloyl esterase B-2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeB-2 PE=3 SV=1 3 329 7.0E-102
sp|B8NPA4|FAEB1_ASPFN Probable feruloyl esterase B-1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeB-1 PE=3 SV=1 3 329 8.0E-102
sp|B0Y7U1|FAEB2_ASPFC Probable feruloyl esterase B-2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=faeB-2 PE=3 SV=1 4 329 9.0E-102
sp|B0YDW9|FAEB1_ASPFC Probable feruloyl esterase B-1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=faeB-1 PE=3 SV=1 4 329 3.0E-101
sp|Q2UP89|FAEB1_ASPOR Probable feruloyl esterase B-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeB-1 PE=1 SV=1 4 329 2.0E-100
sp|Q4W8Z9|FAEB1_ASPFU Probable feruloyl esterase B-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=faeB-1 PE=3 SV=1 4 329 3.0E-100
sp|Q5BCF8|FAEB_EMENI Probable feruloyl esterase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=faeB PE=3 SV=1 3 329 1.0E-99
sp|A1DKV3|FAEB1_NEOFI Probable feruloyl esterase B-1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=faeB-1 PE=3 SV=1 4 329 1.0E-98
sp|Q0CI21|FAEB2_ASPTN Probable feruloyl esterase B-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeB-2 PE=3 SV=2 4 329 9.0E-98
sp|B8LV47|FAEC_TALSN Feruloyl esterase C OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=faeC PE=1 SV=1 3 329 9.0E-97
sp|A1CTK4|FAEB_ASPCL Probable feruloyl esterase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=faeB PE=3 SV=1 4 329 1.0E-94
sp|Q8WZI8|FAEB_ASPNG Feruloyl esterase B OS=Aspergillus niger GN=faeB PE=1 SV=1 2 329 2.0E-85
sp|A2R0Z6|FAEB_ASPNC Probable feruloyl esterase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeB PE=3 SV=1 2 329 5.0E-85
sp|B8NPT0|FAEB2_ASPFN Probable feruloyl esterase B-2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeB-2 PE=3 SV=1 3 310 3.0E-84
sp|Q8P8Y5|Y2094_XANCP Uncharacterized protein XCC2094 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC2094 PE=3 SV=1 1 331 5.0E-31
sp|D4AS70|FAE1_ARTBC Probable feruloyl esterase ARB_07085 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07085 PE=1 SV=1 1 330 1.0E-29
sp|Q8UK62|Y5261_AGRFC Uncharacterized protein Atu5261 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu5261 PE=3 SV=1 3 330 4.0E-16
sp|P78581|TAN_ASPOR Tannase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090103000074 PE=1 SV=1 183 330 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9757
MQAQEFPDQFDGIVAGAPAFDFNALSYWAGRFYKATGPPGSPTFLSAQEWDTVYADILKQCDALDGAVDGILEAP
ELCHYSPASIVCRTDQKENCLVAEKAATVDIAFSPVYDDRGKLIYPRLQPGCNSTDQYFSGYPAPYPTDWYRFVV
YNDSSWDPRTLRLKDYVAGQQLNPFNIATWSGDLSRFHRRRGKLLHLHGLQDPIISSEISNRYYGLVSETMGLGP
AELDDFYRYFRISGLAHCEDGTGSNFIGLSEKLAASRAPEENVLSAIVKWVEEDMAPETILGTKFANGRRGGRVL
AQRRHCKYPLMNKYRGSGNPSSPESWECVEKVELEMSLLPR*
Coding >Hirsu2|9757
ATGCAGGCCCAGGAGTTCCCCGATCAGTTCGACGGCATCGTGGCTGGCGCGCCCGCTTTCGACTTCAACGCTCTC
AGCTATTGGGCGGGGAGGTTCTACAAGGCTACCGGTCCGCCAGGGTCTCCGACGTTTCTGTCTGCGCAGGAATGG
GATACAGTCTATGCGGATATCCTGAAGCAGTGCGATGCCCTGGACGGAGCAGTCGACGGCATCCTGGAAGCCCCC
GAACTCTGCCACTACAGCCCTGCGTCTATCGTTTGTCGTACCGACCAAAAAGAGAATTGCCTCGTCGCCGAAAAG
GCTGCCACGGTCGACATCGCATTTTCGCCGGTCTACGACGATAGGGGAAAGCTGATCTATCCCCGCCTCCAGCCG
GGATGTAATTCCACTGATCAGTACTTTTCCGGCTATCCGGCCCCCTACCCTACCGACTGGTACCGTTTTGTAGTC
TACAACGACTCCTCGTGGGATCCACGAACGCTGAGGCTCAAGGACTACGTGGCCGGGCAGCAGCTCAATCCTTTC
AATATCGCCACCTGGAGTGGTGATCTATCCCGGTTCCATCGACGCCGGGGTAAGTTGCTGCACCTTCATGGATTG
CAAGACCCCATCATCAGTAGTGAGATCTCCAACCGATACTACGGCCTGGTTTCGGAGACAATGGGTCTGGGCCCC
GCCGAGCTCGACGATTTCTACCGATATTTTCGCATATCGGGCCTGGCACACTGCGAGGATGGGACAGGGTCCAAT
TTCATCGGATTGTCCGAAAAGCTAGCCGCGAGCCGTGCGCCCGAAGAGAATGTCTTGTCGGCGATTGTCAAATGG
GTAGAGGAGGACATGGCGCCGGAAACAATCCTCGGAACCAAATTCGCCAACGGTCGAAGGGGGGGTCGAGTTCTT
GCCCAAAGACGGCACTGCAAGTATCCGCTGATGAACAAGTACCGTGGTTCGGGAAATCCGAGTTCGCCGGAGAGC
TGGGAATGTGTCGAGAAGGTTGAGCTGGAAATGAGTTTACTTCCTCGATGA
Transcript >Hirsu2|9757
ATGCAGGCCCAGGAGTTCCCCGATCAGTTCGACGGCATCGTGGCTGGCGCGCCCGCTTTCGACTTCAACGCTCTC
AGCTATTGGGCGGGGAGGTTCTACAAGGCTACCGGTCCGCCAGGGTCTCCGACGTTTCTGTCTGCGCAGGAATGG
GATACAGTCTATGCGGATATCCTGAAGCAGTGCGATGCCCTGGACGGAGCAGTCGACGGCATCCTGGAAGCCCCC
GAACTCTGCCACTACAGCCCTGCGTCTATCGTTTGTCGTACCGACCAAAAAGAGAATTGCCTCGTCGCCGAAAAG
GCTGCCACGGTCGACATCGCATTTTCGCCGGTCTACGACGATAGGGGAAAGCTGATCTATCCCCGCCTCCAGCCG
GGATGTAATTCCACTGATCAGTACTTTTCCGGCTATCCGGCCCCCTACCCTACCGACTGGTACCGTTTTGTAGTC
TACAACGACTCCTCGTGGGATCCACGAACGCTGAGGCTCAAGGACTACGTGGCCGGGCAGCAGCTCAATCCTTTC
AATATCGCCACCTGGAGTGGTGATCTATCCCGGTTCCATCGACGCCGGGGTAAGTTGCTGCACCTTCATGGATTG
CAAGACCCCATCATCAGTAGTGAGATCTCCAACCGATACTACGGCCTGGTTTCGGAGACAATGGGTCTGGGCCCC
GCCGAGCTCGACGATTTCTACCGATATTTTCGCATATCGGGCCTGGCACACTGCGAGGATGGGACAGGGTCCAAT
TTCATCGGATTGTCCGAAAAGCTAGCCGCGAGCCGTGCGCCCGAAGAGAATGTCTTGTCGGCGATTGTCAAATGG
GTAGAGGAGGACATGGCGCCGGAAACAATCCTCGGAACCAAATTCGCCAACGGTCGAAGGGGGGGTCGAGTTCTT
GCCCAAAGACGGCACTGCAAGTATCCGCTGATGAACAAGTACCGTGGTTCGGGAAATCCGAGTTCGCCGGAGAGC
TGGGAATGTGTCGAGAAGGTTGAGCTGGAAATGAGTTTACTTCCTCGATGA
Gene >Hirsu2|9757
ATGCAGGCCCAGGAGTTCCCCGATCAGTTCGACGGCATCGTGGCTGGCGCGCCCGCTTTCGACTTCAACGCTCTC
AGCTATTGGGCGGGGAGGTTCTACAAGGCTACCGGTCCGCCAGGGTCTCCGACGTTTCTGTCTGCGCAGGAATGG
GATACAGTCTATGCGGATATCCTGAAGCAGTGCGATGCCCTGGACGGAGCAGTCGACGGCATCCTGGAAGCCCCC
GAACTCTGCCACTACAGCCCTGCGTCTATCGTTTGTCGTACCGACCAAAAAGAGAATTGCCTCGTCGCCGAAAAG
GCTGCCACGGTCGACATCGCATTTTCGCCGGTCTACGACGATAGGGGAAAGCTGATCTATCCCCGCCTCCAGCCG
GGATGTAATTCCACTGATCAGTACTTTTCCGGCTATCCGGCCCCCTACCCTACCGACTGGTACCGTTTTGTAGTC
TACAACGACTCCTCGTGGGATCCACGAACGCTGAGGCTCAAGGACTACGTGGCCGGGCAGCAGCTCAATCCTTTC
AATATCGCCACCTGGAGTGGTGATCTATCCCGGTTCCATCGACGCCGGGGTAAGTTGCTGCACCTTCATGGATTG
CAAGACCCCATCATCAGTAGTGAGATCTCCAACCGATACTACGGCCTGGTTTCGGAGACAATGGGTCTGGGCCCC
GCCGAGCTCGACGATTTCTACCGATATTTTCGCATATCGGGCCTGGCACACTGCGAGGATGGGACAGGGTCCAAT
TTCATCGGATTGTCCGAAAAGCTAGCCGCGAGCCGTGCGCCCGAAGAGAATGTCTTGTCGGCGATTGTCAAATGG
GTAGAGGAGGACATGGCGCCGGAAACAATCCTCGGAACCAAATTCGCCAACGGTCGAAGGGGGGGTCGAGTTCTT
GCCCAAAGACGGCACTGCAAGTATCCGCTGATGAACAAGTACCGTGGTTCGGGAAATCCGAGTTCGCCGGAGAGC
TGGGAATGTGTCGAGAAGGTTGAGCTGGAAATGAGTTTACTTCCTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail