Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9754
Gene name
LocationContig_731:12791..13262
Strand-
Gene length (bp)471
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21334|CRTI_NEUCR Phytoene desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-1 PE=1 SV=1 6 117 8.0E-31
sp|P48537|CRTI_CERNC Phytoene desaturase OS=Cercospora nicotianae GN=PDH1 PE=3 SV=1 8 151 3.0E-27
sp|P54982|CRTI_PHYB8 Phytoene desaturase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=carB PE=3 SV=1 7 114 1.0E-25
sp|Q4L975|CRTN_STAHJ Dehydrosqualene desaturase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=crtN PE=3 SV=2 11 117 5.0E-16
sp|P54979|CRTJ_MYXXA zeta-carotene-forming phytoene desaturase OS=Myxococcus xanthus GN=carA2 PE=1 SV=1 29 143 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21334|CRTI_NEUCR Phytoene desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-1 PE=1 SV=1 6 117 8.0E-31
sp|P48537|CRTI_CERNC Phytoene desaturase OS=Cercospora nicotianae GN=PDH1 PE=3 SV=1 8 151 3.0E-27
sp|P54982|CRTI_PHYB8 Phytoene desaturase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=carB PE=3 SV=1 7 114 1.0E-25
sp|Q4L975|CRTN_STAHJ Dehydrosqualene desaturase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=crtN PE=3 SV=2 11 117 5.0E-16
sp|P54979|CRTJ_MYXXA zeta-carotene-forming phytoene desaturase OS=Myxococcus xanthus GN=carA2 PE=1 SV=1 29 143 4.0E-13
sp|Q7A3E2|CRTN_STAAN Dehydrosqualene desaturase OS=Staphylococcus aureus (strain N315) GN=crtN PE=1 SV=1 9 121 1.0E-12
sp|Q99R76|CRTN_STAAM Dehydrosqualene desaturase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=crtN PE=3 SV=1 9 121 1.0E-12
sp|O07855|CRTN_STAAE Dehydrosqualene desaturase OS=Staphylococcus aureus (strain Newman) GN=crtN PE=1 SV=2 9 121 1.0E-12
sp|Q5HCY9|CRTN_STAAC Dehydrosqualene desaturase OS=Staphylococcus aureus (strain COL) GN=crtN PE=3 SV=1 9 121 1.0E-12
sp|Q2FV60|CRTN_STAA8 Dehydrosqualene desaturase OS=Staphylococcus aureus (strain NCTC 8325) GN=crtN PE=3 SV=1 9 121 1.0E-12
sp|Q2FDU6|CRTN_STAA3 Dehydrosqualene desaturase OS=Staphylococcus aureus (strain USA300) GN=crtN PE=3 SV=1 9 121 1.0E-12
sp|Q6GDN7|CRTN_STAAR Dehydrosqualene desaturase OS=Staphylococcus aureus (strain MRSA252) GN=crtN PE=3 SV=1 9 121 1.0E-12
sp|Q8NUQ6|CRTN_STAAW Dehydrosqualene desaturase OS=Staphylococcus aureus (strain MW2) GN=crtN PE=3 SV=1 9 121 4.0E-12
sp|Q6G6B3|CRTN_STAAS Dehydrosqualene desaturase OS=Staphylococcus aureus (strain MSSA476) GN=crtN PE=3 SV=1 9 121 4.0E-12
sp|Q2YWE8|CRTN_STAAB Dehydrosqualene desaturase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=crtN PE=3 SV=1 9 121 5.0E-12
sp|Q02861|CRTI_MYXXA All-trans-zeta-carotene desaturase OS=Myxococcus xanthus GN=carC PE=1 SV=1 10 114 1.0E-11
sp|P17054|CRTI_RHOCB Phytoene desaturase (neurosporene-forming) OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtI PE=1 SV=1 1 114 2.0E-11
sp|P22871|CRTI_ESCVU Phytoene desaturase (lycopene-forming) OS=Escherichia vulneris GN=crtI PE=3 SV=1 6 117 1.0E-08
sp|P54978|CRTI_PARSN Phytoene desaturase (lycopene-forming) OS=Paracoccus sp. (strain N81106 / MBIC 01143) GN=crtI PE=3 SV=2 25 117 6.0E-08
sp|P21685|CRTI_PANAN Phytoene desaturase (lycopene-forming) OS=Pantoea ananas GN=crtI PE=1 SV=1 35 117 1.0E-07
sp|Q6G6B0|CRTP_STAAS Diapolycopene oxygenase OS=Staphylococcus aureus (strain MSSA476) GN=crtP PE=3 SV=1 20 116 3.0E-07
sp|Q8NUQ3|CRTP_STAAW Diapolycopene oxygenase OS=Staphylococcus aureus (strain MW2) GN=crtP PE=3 SV=1 20 116 3.0E-07
sp|Q2YWE5|CRTP_STAAB Diapolycopene oxygenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=crtP PE=3 SV=1 20 116 4.0E-07
sp|Q6GDN5|CRTP_STAAR Diapolycopene oxygenase OS=Staphylococcus aureus (strain MRSA252) GN=crtP PE=3 SV=1 20 116 5.0E-07
sp|Q7A3D9|CRTP_STAAN Diapolycopene oxygenase OS=Staphylococcus aureus (strain N315) GN=crtP PE=1 SV=1 20 116 5.0E-07
sp|Q99R73|CRTP_STAAM Diapolycopene oxygenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=crtP PE=1 SV=1 20 116 5.0E-07
sp|Q53589|CRTP_STAAE Diapolycopene oxygenase OS=Staphylococcus aureus (strain Newman) GN=crtP PE=3 SV=2 20 116 5.0E-07
sp|Q5HCY6|CRTP_STAAC Diapolycopene oxygenase OS=Staphylococcus aureus (strain COL) GN=crtP PE=3 SV=1 20 116 5.0E-07
sp|Q2FV57|CRTP_STAA8 Diapolycopene oxygenase OS=Staphylococcus aureus (strain NCTC 8325) GN=crtP PE=1 SV=1 20 116 5.0E-07
sp|Q2FDU3|CRTP_STAA3 Diapolycopene oxygenase OS=Staphylococcus aureus (strain USA300) GN=crtP PE=3 SV=1 20 116 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 130 149 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9754
LPADGGDDGTDWPALVDAVRRFVLDTVEARTGERGLRDGLVAESVDTPPSWRAKFNLDRGAILGLSHGLSNVLAF
RPRTRHPRYRGLYFVGSSTHPGAGVPVCLAGGKIVSEQILADWDRAGRRWTTARGLCWVAALALALPLFVWLFSR
LSPGSL*
Coding >Hirsu2|9754
CTGCCGGCCGACGGCGGCGACGACGGCACCGACTGGCCCGCCCTCGTCGACGCCGTCCGCCGCTTCGTCCTCGAC
ACCGTCGAGGCCCGCACCGGCGAGCGCGGCCTGCGCGACGGCCTGGTCGCCGAGTCGGTCGACACGCCGCCCAGC
TGGCGCGCCAAGTTCAACCTCGACCGCGGCGCCATCCTCGGCCTGTCGCACGGCCTGTCCAACGTGCTGGCCTTC
CGGCCCCGCACCCGCCACCCCCGCTACCGCGGCCTGTACTTTGTCGGCTCCAGCACCCACCCCGGCGCCGGCGTC
CCGGTCTGCCTGGCCGGCGGCAAGATCGTCAGCGAGCAGATCCTCGCCGACTGGGACCGGGCCGGCAGGCGGTGG
ACGACGGCCCGCGGCCTCTGCTGGGTTGCCGCCCTCGCCCTCGCCCTCCCGCTCTTTGTCTGGCTGTTCTCACGC
CTCTCCCCGGGCTCTCTGTAG
Transcript >Hirsu2|9754
CTGCCGGCCGACGGCGGCGACGACGGCACCGACTGGCCCGCCCTCGTCGACGCCGTCCGCCGCTTCGTCCTCGAC
ACCGTCGAGGCCCGCACCGGCGAGCGCGGCCTGCGCGACGGCCTGGTCGCCGAGTCGGTCGACACGCCGCCCAGC
TGGCGCGCCAAGTTCAACCTCGACCGCGGCGCCATCCTCGGCCTGTCGCACGGCCTGTCCAACGTGCTGGCCTTC
CGGCCCCGCACCCGCCACCCCCGCTACCGCGGCCTGTACTTTGTCGGCTCCAGCACCCACCCCGGCGCCGGCGTC
CCGGTCTGCCTGGCCGGCGGCAAGATCGTCAGCGAGCAGATCCTCGCCGACTGGGACCGGGCCGGCAGGCGGTGG
ACGACGGCCCGCGGCCTCTGCTGGGTTGCCGCCCTCGCCCTCGCCCTCCCGCTCTTTGTCTGGCTGTTCTCACGC
CTCTCCCCGGGCTCTCTGTAG
Gene >Hirsu2|9754
CTGCCGGCCGACGGCGGCGACGACGGCACCGACTGGCCCGCCCTCGTCGACGCCGTCCGCCGCTTCGTCCTCGAC
ACCGTCGAGGCCCGCACCGGCGAGCGCGGCCTGCGCGACGGCCTGGTCGCCGAGTCGGTCGACACGCCGCCCAGC
TGGCGCGCCAAGTTCAACCTCGACCGCGGCGCCATCCTCGGCCTGTCGCACGGCCTGTCCAACGTGCTGGCCTTC
CGGCCCCGCACCCGCCACCCCCGCTACCGCGGCCTGTACTTTGTCGGCTCCAGCACCCACCCCGGCGCCGGCGTC
CCGGTCTGCCTGGCCGGCGGCAAGATCGTCAGCGAGCAGATCCTCGCCGACTGGGACCGGGCCGGCAGGCGGTGG
ACGACGGCCCGCGGCCTCTGCTGGGTTGCCGCCCTCGCCCTCGCCCTCCCGCTCTTTGTCTGGCTGTTCTCACGC
CTCTCCCCGGGCTCTCTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail